npm package discovery and stats viewer.

Discover Tips

  • General search

    [free text search, go nuts!]

  • Package details

    pkg:[package-name]

  • User packages

    @[username]

Sponsor

Optimize Toolset

I’ve always been into building performant and accessible sites, but lately I’ve been taking it extremely seriously. So much so that I’ve been building a tool to help me optimize and monitor the sites that I build to make sure that I’m making an attempt to offer the best experience to those who visit them. If you’re into performant, accessible and SEO friendly sites, you might like it too! You can check it out at Optimize Toolset.

About

Hi, 👋, I’m Ryan Hefner  and I built this site for me, and you! The goal of this site was to provide an easy way for me to check the stats on my npm packages, both for prioritizing issues and updates, and to give me a little kick in the pants to keep up on stuff.

As I was building it, I realized that I was actually using the tool to build the tool, and figured I might as well put this out there and hopefully others will find it to be a fast and useful way to search and browse npm packages as I have.

If you’re interested in other things I’m working on, follow me on Twitter or check out the open source projects I’ve been publishing on GitHub.

I am also working on a Twitter bot for this site to tweet the most popular, newest, random packages from npm. Please follow that account now and it will start sending out packages soon–ish.

Open Software & Tools

This site wouldn’t be possible without the immense generosity and tireless efforts from the people who make contributions to the world and share their work via open source initiatives. Thank you 🙏

© 2024 – Pkg Stats / Ryan Hefner

biomass

v0.2.0

Published

Generate bio data from sunlight and alphabets

Downloads

1

Readme

biomass Build Status

Generate bio data from sunlight and alphabets

NPM

Install

Install biomass with npm:

$ npm install biomass

If you are using biomass with Node.js, you can require the module:

var biomass = require('biomass');

Alternatively, just include biomass.min.js via a <script/> in your page.

<script src="../biomass.min.js"></script>

Usage

// Sequence functions will return between 10 and 100 characters if a length is not specified:
biomass.dna();
=> 'CATAGGGACCAAGCTCTGGGGAGCAACCCATAAGCACGACAATCGCGATAATACGTAGTACGCCGCTTGGTTCGTGCCTTCCCGCGCG'
biomass.rna();
=> 'GAGUAGGCUAGGCAUAGC'
biomass.dna({length: 15});
=> 'TTTTGTATGCGTACG'
biomass.rna({length: 3});
=> 'UAC'
biomass.rna({length: 3, case: "lower"});
=> 'uga'
biomass.protein();
=> 'YHAVPVPEEYWRWNTEDVCNTFECMEVINAYRNWFFWLQEFMGPERLPAHMYCHDASAPMMFQGCWDHEEKDMGCVGP'
biomass.protein({ambiguous: true});
=> 'FAFNDMLCXVYPRVQATLCLNNAPDIPSMGPKXFRRFLCYPFC'

Changelog

v0.2.0 - September 23, 2014 - Is tiis messaje a libtle bot fuzxy?

  • Added ambiguity to biomass.dna, biomass.rna, and biomass.protein functions. Follows IUPAC notation for ambiguous nucleotides and X unknown amino acids.

v0.1.0 - August 10, 2014 - Eat your protein bars...

  • Added biomass.protein for generating random amino acid sequences.
  • Fix version number to adequately reflect updates

v0.0.2 - July 26, 2014 - Uptown, downtown...

  • Now biomass.dna and biomass.rna are case aware with a default response of uppercase letters.

v0.0.1 - July 21, 2014 - Dawn

Initial release

  • Added biomass.dna for generating random DNA sequences.
  • Added biomass.rna for generating random RNA sequences.

Contacts

Alan Rice <[email protected]> @alanmrice

License

biomass is licensed under the MIT license.
Check ChooseALicense.com for details.