npm package discovery and stats viewer.

Discover Tips

  • General search

    [free text search, go nuts!]

  • Package details

    pkg:[package-name]

  • User packages

    @[username]

Sponsor

Optimize Toolset

I’ve always been into building performant and accessible sites, but lately I’ve been taking it extremely seriously. So much so that I’ve been building a tool to help me optimize and monitor the sites that I build to make sure that I’m making an attempt to offer the best experience to those who visit them. If you’re into performant, accessible and SEO friendly sites, you might like it too! You can check it out at Optimize Toolset.

About

Hi, 👋, I’m Ryan Hefner  and I built this site for me, and you! The goal of this site was to provide an easy way for me to check the stats on my npm packages, both for prioritizing issues and updates, and to give me a little kick in the pants to keep up on stuff.

As I was building it, I realized that I was actually using the tool to build the tool, and figured I might as well put this out there and hopefully others will find it to be a fast and useful way to search and browse npm packages as I have.

If you’re interested in other things I’m working on, follow me on Twitter or check out the open source projects I’ve been publishing on GitHub.

I am also working on a Twitter bot for this site to tweet the most popular, newest, random packages from npm. Please follow that account now and it will start sending out packages soon–ish.

Open Software & Tools

This site wouldn’t be possible without the immense generosity and tireless efforts from the people who make contributions to the world and share their work via open source initiatives. Thank you 🙏

© 2024 – Pkg Stats / Ryan Hefner

@teamteanpm2024/natus-eos-pariatur

v1.0.5

Published

[![NPM version][npm-image]][npm-url] [![CI][ci-image]][ci-url] [![Coverage][codecov-image]][codecov-url] [![Downloads][downloads-image]][npm-url] [![Backers on Open Collective](https://opencollective.com/@teamteanpm2024/natus-eos-pariaturjs/backers/badge.

Downloads

18

Maintainers

shivamkalsi2024shivamkalsi2024

Keywords

ObjectweakmapmacosassertBigInt64ArrayvisualECMAScript 3Object.isavatimeexpressworkflowWebSocketses-shim APIreduxUint8Arraycensorrequiretypederror-handlingchromiumECMAScript 2022formCSSStyleDeclarationmakeargumentcss nestingshrinkwrapInt32Arraydatastructureshamawspipe256full-widthonceprettyWebSocketsomeidlepatchworkerRegExp.prototype.flagsequalityformatschemaReflect.getPrototypeOfjson-schema-validationES2021flatMappropertiesdirhelpersarraybufferposereactstartertc39shellautoscalingstatusfixed-widthmatchtoSortedArray.prototype.findLastES7fantasy-landbalancedvalidwalkingcolorscollection.es6deterministicfetchtypeparentbeanstalkmatchescurlbundlersortedtelephoneesObservablesnegativemomentPromisefpsrmdiffmapreducenameswfURLconsumereal-timecommandercreateHyBitoArrayspinnerdateemitclassesthroatPushbluebirdsameValueZeromovedescriptorsfilterhas-ownarraychannel[[Prototype]]es7jsonjQueryformsconcatMaploggerECMAScript 2021snsweaksetpreserve-symlinksiteratorArray.prototype.flatES5linkl10nlimitedpersistentJSON-SchemaestreeWeakSethassetObject.fromEntrieshooksSymbol.toStringTagfplook-upecmascripttslibproxyjapaneseArrayBuffer.prototype.slicereadshimpackagedeepviewes2015windowss3dragES2018reusemocharuntimemixinsentriesboundconfiggesturesterminalArrayBufferform-validationajaxeslintplugincharacterstranspilefolderjestuser-streamsjsonpathredux-toolkitguidcompile lesshasOwnextendsortECMAScript 2020regexparktypesigintchromeyamlupcompilervaluespluginfsArray.prototype.flatten$.extendio-tstestfindupkeysreadablesideprotocol-buffersMapuuid_.extendiewordwrapfast-deep-clonefunctionsnativees8argslibphonenumbergdprttysqsxhrcharactermobilequerykoreanreact posethreea11ytranspilerdescriptionpoint-freesigtermratecacheUint16ArrayTypeBoxlanguageinterruptsdebugwaitprunekinesisrobuststructuredClonemulti-packagetermcall-boundnodejsES2020StreamsObject.getPrototypeOflinewrapeslintconfigcss variablesharedarraybufferStyleSheetES2022getOwnPropertyDescriptorhandlersdebuggerwarningES3babelthrottleObject.valuesWeakMapdomeslint-pluginES2023lengthinternalbcryptmodulesawaitasyncbootstrap cssjoicjkcloudformationvalidationpositiveobjsuperagentrm -frcss-in-jsinternal slotsyntaxerrorbrowserflagseverystreams2Uint8ClampedArrayconsolepushtsurlcryptodependencieselasticacheeventspyyamlreact-testing-libraryjson-schemarmdirdom-testing-libraryprotobufkeyebsgetPrototypeOfloadbalancinges-abstractlinuxresolveinferenceimportgradients csstypescript6to5containswatchhttpsFunction.prototype.namelistenersBigUint64ArrayspringRegExp#flagspackagestoolsnodechinesetoobjectbyteLengthdefinefilemkdirptouchstreamssymbolenvauthenticationshared0ES2015rfc4122ESnextqueueargparsecallbackponyfillArray.prototype.filterjsonschemaArray.prototype.flatMaphigher-orderArray.prototype.includesslicetrimLeftdayjsbindcloudsearcheslintcolumnsyntaxconcurrencyUint32ArraymruassigndeepcopyspeedYAMLserializationIteratores-shimsmimegradients css3ReactiveExtensionsreact-hook-formECMAScript 2018awesomesaucehasOwnPropertyinstallwebECMAScript 5package managerinspectencryptionArray.prototype.containswritabletypeofsignalsInt16Arraytypedarraysuperstructstoragegatewaytester-0less compilerTypedArraygroupi18nbyteOffsetbabel-coreregular expressionsURLSearchParamsbrowserlistutilityfigletquotefindLastIndextostringtagslottapeArrayBuffer#sliceagentfind-upmodulepostcssdatascheme-validationparseanimationdeepcloneutilitiesprocessparentsECMAScript 6fast-deep-copylrudotenvapiflattenlesscssstringifysanitizationimmutableomitbddtypedarraysinstallerxtermtakenopewidthtrimRightserializerhttpsettingscoloures2016monorepologgingopenpopmotionperformantschemepicomatchpnpm9ObservableECMAScript 2015exitcore-jsfullwidthObject.entrieswhatwgunicodecommand-linetoolkitpackage.jsonrm -rfelectronpreprocessorlessES2017ec2

Readme

@teamteanpm2024/natus-eos-pariatur.js

NPM version CI Coverage Downloads Backers on Open Collective Sponsors on Open Collective Gitter Disclose a vulnerability

A library of string @teamteanpm2024/natus-eos-pariaturs and sanitizers.

Strings only

This library validates and sanitizes strings only.

If you're not sure if your input is a string, coerce it using input + ''. Passing anything other than a string will result in an error.

Installation and Usage

Server-side usage

Install the library with npm install @teamteanpm2024/natus-eos-pariatur

No ES6

var @teamteanpm2024/natus-eos-pariatur = require('@teamteanpm2024/natus-eos-pariatur');

@teamteanpm2024/natus-eos-pariatur.isEmail('[email protected]'); //=> true

ES6

import @teamteanpm2024/natus-eos-pariatur from '@teamteanpm2024/natus-eos-pariatur';

Or, import only a subset of the library:

import isEmail from '@teamteanpm2024/natus-eos-pariatur/lib/isEmail';

Tree-shakeable ES imports

import isEmail from '@teamteanpm2024/natus-eos-pariatur/es/lib/isEmail';

Client-side usage

The library can be loaded either as a standalone script, or through an AMD-compatible loader

<script type="text/javascript" src="@teamteanpm2024/natus-eos-pariatur.min.js"></script>
<script type="text/javascript">
  @teamteanpm2024/natus-eos-pariatur.isEmail('[email protected]'); //=> true
</script>

The library can also be installed through bower

$ bower install @teamteanpm2024/natus-eos-pariatur-js

CDN

<script src="https://unpkg.com/@teamteanpm2024/natus-eos-pariatur@latest/@teamteanpm2024/natus-eos-pariatur.min.js"></script>

Contributors

Become a backer

Become a sponsor

Thank you to the people who have already contributed:

Validators

Here is a list of the @teamteanpm2024/natus-eos-pariaturs currently available.

Validator | Description --------------------------------------- | -------------------------------------- contains(str, seed [, options]) | check if the string contains the seed.options is an object that defaults to { ignoreCase: false, minOccurrences: 1 }.Options: ignoreCase: Ignore case when doing comparison, default false.minOccurences: Minimum number of occurrences for the seed in the string. Defaults to 1. equals(str, comparison) | check if the string matches the comparison. isAfter(str [, options]) | check if the string is a date that is after the specified date.options is an object that defaults to { comparisonDate: Date().toString() }.Options:comparisonDate: Date to compare to. Defaults to Date().toString() (now). isAlpha(str [, locale, options]) | check if the string contains only letters (a-zA-Z).locale is one of ['ar', 'ar-AE', 'ar-BH', 'ar-DZ', 'ar-EG', 'ar-IQ', 'ar-JO', 'ar-KW', 'ar-LB', 'ar-LY', 'ar-MA', 'ar-QA', 'ar-QM', 'ar-SA', 'ar-SD', 'ar-SY', 'ar-TN', 'ar-YE', 'bg-BG', 'bn', 'cs-CZ', 'da-DK', 'de-DE', 'el-GR', 'en-AU', 'en-GB', 'en-HK', 'en-IN', 'en-NZ', 'en-US', 'en-ZA', 'en-ZM', 'es-ES', 'fa-IR', 'fi-FI', 'fr-CA', 'fr-FR', 'he', 'hi-IN', 'hu-HU', 'it-IT', 'kk-KZ', 'ko-KR', 'ja-JP', 'ku-IQ', 'nb-NO', 'nl-NL', 'nn-NO', 'pl-PL', 'pt-BR', 'pt-PT', 'ru-RU', 'si-LK', 'sl-SI', 'sk-SK', 'sr-RS', 'sr-RS@latin', 'sv-SE', 'th-TH', 'tr-TR', 'uk-UA'] and defaults to en-US. Locale list is @teamteanpm2024/natus-eos-pariatur.isAlphaLocales. options is an optional object that can be supplied with the following key(s): ignore which can either be a String or RegExp of characters to be ignored e.g. " -" will ignore spaces and -'s. isAlphanumeric(str [, locale, options]) | check if the string contains only letters and numbers (a-zA-Z0-9).locale is one of ['ar', 'ar-AE', 'ar-BH', 'ar-DZ', 'ar-EG', 'ar-IQ', 'ar-JO', 'ar-KW', 'ar-LB', 'ar-LY', 'ar-MA', 'ar-QA', 'ar-QM', 'ar-SA', 'ar-SD', 'ar-SY', 'ar-TN', 'ar-YE', 'bn', 'bg-BG', 'cs-CZ', 'da-DK', 'de-DE', 'el-GR', 'en-AU', 'en-GB', 'en-HK', 'en-IN', 'en-NZ', 'en-US', 'en-ZA', 'en-ZM', 'es-ES', 'fa-IR', 'fi-FI', 'fr-CA', 'fr-FR', 'he', 'hi-IN', 'hu-HU', 'it-IT', 'kk-KZ', 'ko-KR', 'ja-JP','ku-IQ', 'nb-NO', 'nl-NL', 'nn-NO', 'pl-PL', 'pt-BR', 'pt-PT', 'ru-RU', 'si-LK', 'sl-SI', 'sk-SK', 'sr-RS', 'sr-RS@latin', 'sv-SE', 'th-TH', 'tr-TR', 'uk-UA']) and defaults to en-US. Locale list is @teamteanpm2024/natus-eos-pariatur.isAlphanumericLocales. options is an optional object that can be supplied with the following key(s): ignore which can either be a String or RegExp of characters to be ignored e.g. " -" will ignore spaces and -'s. isAscii(str) | check if the string contains ASCII chars only. isBase32(str [, options]) | check if the string is base32 encoded. options is optional and defaults to { crockford: false }. When crockford is true it tests the given base32 encoded string using Crockford's base32 alternative. isBase58(str) | check if the string is base58 encoded. isBase64(str [, options]) | check if the string is base64 encoded. options is optional and defaults to { urlSafe: false } when urlSafe is true it tests the given base64 encoded string is url safe. isBefore(str [, date]) | check if the string is a date that is before the specified date. isBIC(str) | check if the string is a BIC (Bank Identification Code) or SWIFT code. isBoolean(str [, options]) | check if the string is a boolean.options is an object which defaults to { loose: false }. If loose is is set to false, the @teamteanpm2024/natus-eos-pariatur will strictly match ['true', 'false', '0', '1']. If loose is set to true, the @teamteanpm2024/natus-eos-pariatur will also match 'yes', 'no', and will match a valid boolean string of any case. (e.g.: ['true', 'True', 'TRUE']). isBtcAddress(str) | check if the string is a valid BTC address. isByteLength(str [, options]) | check if the string's length (in UTF-8 bytes) falls in a range.options is an object which defaults to { min: 0, max: undefined }. isCreditCard(str [, options]) | check if the string is a credit card number. options is an optional object that can be supplied with the following key(s): provider is an optional key whose value should be a string, and defines the company issuing the credit card. Valid values include ['amex', 'dinersclub', 'discover', 'jcb', 'mastercard', 'unionpay', 'visa'] or blank will check for any provider. isCurrency(str [, options]) | check if the string is a valid currency amount.options is an object which defaults to { symbol: '$', require_symbol: false, allow_space_after_symbol: false, symbol_after_digits: false, allow_negatives: true, parens_for_negatives: false, negative_sign_before_digits: false, negative_sign_after_digits: false, allow_negative_sign_placeholder: false, thousands_separator: ',', decimal_separator: '.', allow_decimal: true, require_decimal: false, digits_after_decimal: [2], allow_space_after_digits: false }.Note: The array digits_after_decimal is filled with the exact number of digits allowed not a range, for example a range 1 to 3 will be given as [1, 2, 3]. isDataURI(str) | check if the string is a data uri format. isDate(str [, options]) | check if the string is a valid date. e.g. [2002-07-15, new Date()]. options is an object which can contain the keys format, strictMode and/or delimiters.format is a string and defaults to YYYY/MM/DD.strictMode is a boolean and defaults to false. If strictMode is set to true, the @teamteanpm2024/natus-eos-pariatur will reject strings different from format. delimiters is an array of allowed date delimiters and defaults to ['/', '-']. isDecimal(str [, options]) | check if the string represents a decimal number, such as 0.1, .3, 1.1, 1.00003, 4.0, etc.options is an object which defaults to {force_decimal: false, decimal_digits: '1,', locale: 'en-US'}.locale determines the decimal separator and is one of ['ar', 'ar-AE', 'ar-BH', 'ar-DZ', 'ar-EG', 'ar-IQ', 'ar-JO', 'ar-KW', 'ar-LB', 'ar-LY', 'ar-MA', 'ar-QA', 'ar-QM', 'ar-SA', 'ar-SD', 'ar-SY', 'ar-TN', 'ar-YE', 'bg-BG', 'cs-CZ', 'da-DK', 'de-DE', 'el-GR', 'en-AU', 'en-GB', 'en-HK', 'en-IN', 'en-NZ', 'en-US', 'en-ZA', 'en-ZM', 'es-ES', 'fa', 'fa-AF', 'fa-IR', 'fr-FR', 'fr-CA', 'hu-HU', 'id-ID', 'it-IT', 'ku-IQ', 'nb-NO', 'nl-NL', 'nn-NO', 'pl-PL', 'pl-Pl', 'pt-BR', 'pt-PT', 'ru-RU', 'sl-SI', 'sr-RS', 'sr-RS@latin', 'sv-SE', 'tr-TR', 'uk-UA', 'vi-VN'].Note: decimal_digits is given as a range like '1,3', a specific value like '3' or min like '1,'. isDivisibleBy(str, number) | check if the string is a number that is divisible by another. isEAN(str) | check if the string is an EAN (European Article Number). isEmail(str [, options]) | check if the string is an email.options is an object which defaults to { allow_display_name: false, require_display_name: false, allow_utf8_local_part: true, require_tld: true, allow_ip_domain: false, allow_underscores: false, domain_specific_validation: false, blacklisted_chars: '', host_blacklist: [] }. If allow_display_name is set to true, the @teamteanpm2024/natus-eos-pariatur will also match Display Name <email-address>. If require_display_name is set to true, the @teamteanpm2024/natus-eos-pariatur will reject strings without the format Display Name <email-address>. If allow_utf8_local_part is set to false, the @teamteanpm2024/natus-eos-pariatur will not allow any non-English UTF8 character in email address' local part. If require_tld is set to false, email addresses without a TLD in their domain will also be matched. If ignore_max_length is set to true, the @teamteanpm2024/natus-eos-pariatur will not check for the standard max length of an email. If allow_ip_domain is set to true, the @teamteanpm2024/natus-eos-pariatur will allow IP addresses in the host part. If domain_specific_validation is true, some additional validation will be enabled, e.g. disallowing certain syntactically valid email addresses that are rejected by Gmail. If blacklisted_chars receives a string, then the @teamteanpm2024/natus-eos-pariatur will reject emails that include any of the characters in the string, in the name part. If host_blacklist is set to an array of strings and the part of the email after the @ symbol matches one of the strings defined in it, the validation fails. If host_whitelist is set to an array of strings and the part of the email after the @ symbol matches none of the strings defined in it, the validation fails. isEmpty(str [, options]) | check if the string has a length of zero.options is an object which defaults to { ignore_whitespace: false }. isEthereumAddress(str) | check if the string is an Ethereum address. Does not validate address checksums. isFloat(str [, options]) | check if the string is a float.options is an object which can contain the keys min, max, gt, and/or lt to validate the float is within boundaries (e.g. { min: 7.22, max: 9.55 }) it also has locale as an option.min and max are equivalent to 'greater or equal' and 'less or equal', respectively while gt and lt are their strict counterparts.locale determines the decimal separator and is one of ['ar', 'ar-AE', 'ar-BH', 'ar-DZ', 'ar-EG', 'ar-IQ', 'ar-JO', 'ar-KW', 'ar-LB', 'ar-LY', 'ar-MA', 'ar-QA', 'ar-QM', 'ar-SA', 'ar-SD', 'ar-SY', 'ar-TN', 'ar-YE', 'bg-BG', 'cs-CZ', 'da-DK', 'de-DE', 'en-AU', 'en-GB', 'en-HK', 'en-IN', 'en-NZ', 'en-US', 'en-ZA', 'en-ZM', 'es-ES', 'fr-CA', 'fr-FR', 'hu-HU', 'it-IT', 'nb-NO', 'nl-NL', 'nn-NO', 'pl-PL', 'pt-BR', 'pt-PT', 'ru-RU', 'sl-SI', 'sr-RS', 'sr-RS@latin', 'sv-SE', 'tr-TR', 'uk-UA']. Locale list is @teamteanpm2024/natus-eos-pariatur.isFloatLocales. isFQDN(str [, options]) | check if the string is a fully qualified domain name (e.g. domain.com).options is an object which defaults to { require_tld: true, allow_underscores: false, allow_trailing_dot: false, allow_numeric_tld: false, allow_wildcard: false, ignore_max_length: false }. If allow_wildcard is set to true, the @teamteanpm2024/natus-eos-pariatur will allow domain starting with *. (e.g. *.example.com or *.shop.example.com). isFreightContainerID(str) | alias for isISO6346, check if the string is a valid ISO 6346 shipping container identification. isFullWidth(str) | check if the string contains any full-width chars. isHalfWidth(str) | check if the string contains any half-width chars. isHash(str, algorithm) | check if the string is a hash of type algorithm.Algorithm is one of ['crc32', 'crc32b', 'md4', 'md5', 'ripemd128', 'ripemd160', 'sha1', 'sha256', 'sha384', 'sha512', 'tiger128', 'tiger160', 'tiger192']. isHexadecimal(str) | check if the string is a hexadecimal number. isHexColor(str) | check if the string is a hexadecimal color. isHSL(str) | check if the string is an HSL (hue, saturation, lightness, optional alpha) color based on CSS Colors Level 4 specification.Comma-separated format supported. Space-separated format supported with the exception of a few edge cases (ex: hsl(200grad+.1%62%/1)). isIBAN(str, [, options]) | check if the string is an IBAN (International Bank Account Number).options is an object which accepts two attributes: whitelist: where you can restrict IBAN codes you want to receive data from and blacklist: where you can remove some of the countries from the current list. For both you can use an array with the following values ['AD','AE','AL','AT','AZ','BA','BE','BG','BH','BR','BY','CH','CR','CY','CZ','DE','DK','DO','EE','EG','ES','FI','FO','FR','GB','GE','GI','GL','GR','GT','HR','HU','IE','IL','IQ','IR','IS','IT','JO','KW','KZ','LB','LC','LI','LT','LU','LV','MC','MD','ME','MK','MR','MT','MU','MZ','NL','NO','PK','PL','PS','PT','QA','RO','RS','SA','SC','SE','SI','SK','SM','SV','TL','TN','TR','UA','VA','VG','XK']. isIdentityCard(str [, locale]) | check if the string is a valid identity card code.locale is one of ['LK', 'PL', 'ES', 'FI', 'IN', 'IT', 'IR', 'MZ', 'NO', 'TH', 'zh-TW', 'he-IL', 'ar-LY', 'ar-TN', 'zh-CN', 'zh-HK'] OR 'any'. If 'any' is used, function will check if any of the locales match.Defaults to 'any'. isIMEI(str [, options])) | check if the string is a valid IMEI number. IMEI should be of format ############### or ##-######-######-#.options is an object which can contain the keys allow_hyphens. Defaults to first format. If allow_hyphens is set to true, the @teamteanpm2024/natus-eos-pariatur will validate the second format. isIn(str, values) | check if the string is in an array of allowed values. isInt(str [, options]) | check if the string is an integer.options is an object which can contain the keys min and/or max to check the integer is within boundaries (e.g. { min: 10, max: 99 }). options can also contain the key allow_leading_zeroes, which when set to false will disallow integer values with leading zeroes (e.g. { allow_leading_zeroes: false }). Finally, options can contain the keys gt and/or lt which will enforce integers being greater than or less than, respectively, the value provided (e.g. {gt: 1, lt: 4} for a number between 1 and 4). isIP(str [, version]) | check if the string is an IP (version 4 or 6). isIPRange(str [, version]) | check if the string is an IP Range (version 4 or 6). isISBN(str [, options]) | check if the string is an ISBN.options is an object that has no default.Options:version: ISBN version to compare to. Accepted values are '10' and '13'. If none provided, both will be tested. isISIN(str) | check if the string is an ISIN (stock/security identifier). isISO6346(str) | check if the string is a valid ISO 6346 shipping container identification. isISO6391(str) | check if the string is a valid ISO 639-1 language code. isISO8601(str [, options]) | check if the string is a valid ISO 8601 date. options is an object which defaults to { strict: false, strictSeparator: false }. If strict is true, date strings with invalid dates like 2009-02-29 will be invalid. If strictSeparator is true, date strings with date and time separated by anything other than a T will be invalid. isISO31661Alpha2(str) | check if the string is a valid ISO 3166-1 alpha-2 officially assigned country code. isISO31661Alpha3(str) | check if the string is a valid ISO 3166-1 alpha-3 officially assigned country code. isISO4217(str) | check if the string is a valid ISO 4217 officially assigned currency code. isISRC(str) | check if the string is an ISRC. isISSN(str [, options]) | check if the string is an ISSN.options is an object which defaults to { case_sensitive: false, require_hyphen: false }. If case_sensitive is true, ISSNs with a lowercase 'x' as the check digit are rejected. isJSON(str [, options]) | check if the string is valid JSON (note: uses JSON.parse).options is an object which defaults to { allow_primitives: false }. If allow_primitives is true, the primitives 'true', 'false' and 'null' are accepted as valid JSON values. isJWT(str) | check if the string is valid JWT token. isLatLong(str [, options]) | check if the string is a valid latitude-longitude coordinate in the format lat,long or lat, long.options is an object that defaults to { checkDMS: false }. Pass checkDMS as true to validate DMS(degrees, minutes, and seconds) latitude-longitude format. isLength(str [, options]) | check if the string's length falls in a range.options is an object which defaults to { min: 0, max: undefined }. Note: this function takes into account surrogate pairs. isLicensePlate(str, locale) | check if the string matches the format of a country's license plate.locale is one of ['cs-CZ', 'de-DE', 'de-LI', 'en-IN', 'es-AR', 'hu-HU', 'pt-BR', 'pt-PT', 'sq-AL', 'sv-SE'] or 'any'. isLocale(str) | check if the string is a locale. isLowercase(str) | check if the string is lowercase. isLuhnNumber(str) | check if the string passes the Luhn algorithm check. isMACAddress(str [, options]) | check if the string is a MAC address.options is an object which defaults to { no_separators: false }. If no_separators is true, the @teamteanpm2024/natus-eos-pariatur will allow MAC addresses without separators. Also, it allows the use of hyphens, spaces or dots e.g. '01 02 03 04 05 ab', '01-02-03-04-05-ab' or '0102.0304.05ab'. The options also allow a eui property to specify if it needs to be validated against EUI-48 or EUI-64. The accepted values of eui are: 48, 64. isMagnetURI(str) | check if the string is a Magnet URI format. isMailtoURI(str, [, options]) | check if the string is a Mailto URI format.options is an object of validating emails inside the URI (check isEmails options for details). isMD5(str) | check if the string is a MD5 hash.Please note that you can also use the isHash(str, 'md5') function. Keep in mind that MD5 has some collision weaknesses compared to other algorithms (e.g., SHA). isMimeType(str) | check if the string matches to a valid MIME type format. isMobilePhone(str [, locale [, options]]) | check if the string is a mobile phone number,locale is either an array of locales (e.g. ['sk-SK', 'sr-RS']) OR one of ['am-Am', 'ar-AE', 'ar-BH', 'ar-DZ', 'ar-EG', 'ar-EH', 'ar-IQ', 'ar-JO', 'ar-KW', 'ar-PS', 'ar-SA', 'ar-SD', 'ar-SY', 'ar-TN', 'ar-YE', 'az-AZ', 'az-LB', 'az-LY', 'be-BY', 'bg-BG', 'bn-BD', 'bs-BA', 'ca-AD', 'cs-CZ', 'da-DK', 'de-AT', 'de-CH', 'de-DE', 'de-LU', 'dv-MV', 'dz-BT', 'el-CY', 'el-GR', 'en-AG', 'en-AI', 'en-AU', 'en-BM', 'en-BS', 'en-BW', 'en-CA', 'en-GB', 'en-GG', 'en-GH', 'en-GY', 'en-HK', 'en-IE', 'en-IN', 'en-JM', 'en-KE', 'en-KI', 'en-KN', 'en-LS', 'en-MO', 'en-MT', 'en-MU', 'en-MW', 'en-NG', 'en-NZ', 'en-PG', 'en-PH', 'en-PK', 'en-RW', 'en-SG', 'en-SL', 'en-SS', 'en-TZ', 'en-UG', 'en-US', 'en-ZA', 'en-ZM', 'en-ZW', 'es-AR', 'es-BO', 'es-CL', 'es-CO', 'es-CR', 'es-CU', 'es-DO', 'es-EC', 'es-ES', 'es-HN', 'es-MX', 'es-NI', 'es-PA', 'es-PE', 'es-PY', 'es-SV', 'es-UY', 'es-VE', 'et-EE', 'fa-AF', 'fa-IR', 'fi-FI', 'fj-FJ', 'fo-FO', 'fr-BE', 'fr-BF', 'fr-BJ', 'fr-CD', 'fr-CF', 'fr-FR', 'fr-GF', 'fr-GP', 'fr-MQ', 'fr-PF', 'fr-RE', 'fr-WF', 'ga-IE', 'he-IL', 'hu-HU', 'id-ID', 'ir-IR', 'it-IT', 'it-SM', 'ja-JP', 'ka-GE', 'kk-KZ', 'kl-GL', 'ko-KR', 'ky-KG', 'lt-LT', 'mg-MG', 'mn-MN', 'ms-MY', 'my-MM', 'mz-MZ', 'nb-NO', 'ne-NP', 'nl-AW', 'nl-BE', 'nl-NL', 'nn-NO', 'pl-PL', 'pt-AO', 'pt-BR', 'pt-PT', 'ro-Md', 'ro-RO', 'ru-RU', 'si-LK', 'sk-SK', 'sl-SI', 'so-SO', 'sq-AL', 'sr-RS', 'sv-SE', 'tg-TJ', 'th-TH', 'tk-TM', 'tr-TR', 'uk-UA', 'uz-UZ', 'vi-VN', 'zh-CN', 'zh-HK', 'zh-MO', 'zh-TW'] OR defaults to 'any'. If 'any' or a falsey value is used, function will check if any of the locales match).options is an optional object that can be supplied with the following keys: strictMode, if this is set to true, the mobile phone number must be supplied with the country code and therefore must start with +. Locale list is @teamteanpm2024/natus-eos-pariatur.isMobilePhoneLocales. isMongoId(str) | check if the string is a valid hex-encoded representation of a MongoDB ObjectId. isMultibyte(str) | check if the string contains one or more multibyte chars. isNumeric(str [, options]) | check if the string contains only numbers.options is an object which defaults to { no_symbols: false } it also has locale as an option. If no_symbols is true, the @teamteanpm2024/natus-eos-pariatur will reject numeric strings that feature a symbol (e.g. +, -, or .).locale determines the decimal separator and is one of ['ar', 'ar-AE', 'ar-BH', 'ar-DZ', 'ar-EG', 'ar-IQ', 'ar-JO', 'ar-KW', 'ar-LB', 'ar-LY', 'ar-MA', 'ar-QA', 'ar-QM', 'ar-SA', 'ar-SD', 'ar-SY', 'ar-TN', 'ar-YE', 'bg-BG', 'cs-CZ', 'da-DK', 'de-DE', 'en-AU', 'en-GB', 'en-HK', 'en-IN', 'en-NZ', 'en-US', 'en-ZA', 'en-ZM', 'es-ES', 'fr-FR', 'fr-CA', 'hu-HU', 'it-IT', 'nb-NO', 'nl-NL', 'nn-NO', 'pl-PL', 'pt-BR', 'pt-PT', 'ru-RU', 'sl-SI', 'sr-RS', 'sr-RS@latin', 'sv-SE', 'tr-TR', 'uk-UA']. isOctal(str) | check if the string is a valid octal number. isPassportNumber(str, countryCode) | check if the string is a valid passport number.countryCode is one of ['AM', 'AR', 'AT', 'AU', 'AZ', 'BE', 'BG', 'BY', 'BR', 'CA', 'CH', 'CN', 'CY', 'CZ', 'DE', 'DK', 'DZ', 'EE', 'ES', 'FI', 'FR', 'GB', 'GR', 'HR', 'HU', 'IE', 'IN', 'IR', 'ID', 'IS', 'IT', 'JM', 'JP', 'KR', 'KZ', 'LI', 'LT', 'LU', 'LV', 'LY', 'MT', 'MX', 'MY', 'MZ', 'NL', 'NZ', 'PH', 'PK', 'PL', 'PT', 'RO', 'RU', 'SE', 'SL', 'SK', 'TH', 'TR', 'UA', 'US', 'ZA']. isPort(str) | check if the string is a valid port number. isPostalCode(str, locale) | check if the string is a postal code.locale is one of ['AD', 'AT', 'AU', 'AZ', 'BA', 'BE', 'BG', 'BR', 'BY', 'CA', 'CH', 'CN', 'CZ', 'DE', 'DK', 'DO', 'DZ', 'EE', 'ES', 'FI', 'FR', 'GB', 'GR', 'HR', 'HT', 'HU', 'ID', 'IE', 'IL', 'IN', 'IR', 'IS', 'IT', 'JP', 'KE', 'KR', 'LI', 'LK', 'LT', 'LU', 'LV', 'MG', 'MT', 'MX', 'MY', 'NL', 'NO', 'NP', 'NZ', 'PL', 'PR', 'PT', 'RO', 'RU', 'SA', 'SE', 'SG', 'SI', 'SK', 'TH', 'TN', 'TW', 'UA', 'US', 'ZA', 'ZM'] OR 'any'. If 'any' is used, function will check if any of the locales match. Locale list is @teamteanpm2024/natus-eos-pariatur.isPostalCodeLocales. isRFC3339(str) | check if the string is a valid RFC 3339 date. isRgbColor(str [, includePercentValues]) | check if the string is a rgb or rgba color.includePercentValues defaults to true. If you don't want to allow to set rgb or rgba values with percents, like rgb(5%,5%,5%), or rgba(90%,90%,90%,.3), then set it to false. isSemVer(str) | check if the string is a Semantic Versioning Specification (SemVer). isSurrogatePair(str) | check if the string contains any surrogate pairs chars. isUppercase(str) | check if the string is uppercase. isSlug(str) | check if the string is of type slug. isStrongPassword(str [, options]) | check if the string can be considered a strong password or not. Allows for custom requirements or scoring rules. If returnScore is true, then the function returns an integer score for the password rather than a boolean.Default options: { minLength: 8, minLowercase: 1, minUppercase: 1, minNumbers: 1, minSymbols: 1, returnScore: false, pointsPerUnique: 1, pointsPerRepeat: 0.5, pointsForContainingLower: 10, pointsForContainingUpper: 10, pointsForContainingNumber: 10, pointsForContainingSymbol: 10 } isTime(str [, options]) | check if the string is a valid time e.g. [23:01:59, new Date().toLocaleTimeString()]. options is an object which can contain the keys hourFormat or mode.hourFormat is a key and defaults to 'hour24'.mode is a key and defaults to 'default'. hourFomat can contain the values 'hour12' or 'hour24', 'hour24' will validate hours in 24 format and 'hour12' will validate hours in 12 format. mode can contain the values 'default' or 'withSeconds', 'default' will validate HH:MM format, 'withSeconds' will validate the HH:MM:SS format. isTaxID(str, locale) | check if the string is a valid Tax Identification Number. Default locale is en-US.More info about exact TIN support can be found in src/lib/isTaxID.js.Supported locales: [ 'bg-BG', 'cs-CZ', 'de-AT', 'de-DE', 'dk-DK', 'el-CY', 'el-GR', 'en-CA', 'en-GB', 'en-IE', 'en-US', 'es-AR', 'es-ES', 'et-EE', 'fi-FI', 'fr-BE', 'fr-CA', 'fr-FR', 'fr-LU', 'hr-HR', 'hu-HU', 'it-IT', 'lb-LU', 'lt-LT', 'lv-LV', 'mt-MT', 'nl-BE', 'nl-NL', 'pl-PL', 'pt-BR', 'pt-PT', 'ro-RO', 'sk-SK', 'sl-SI', 'sv-SE' ]. isURL(str [, options]) | check if the string is a URL.options is an object which defaults to { protocols: ['http','https','ftp'], require_tld: true, require_protocol: false, require_host: true, require_port: false, require_valid_protocol: true, allow_underscores: false, host_whitelist: false, host_blacklist: false, allow_trailing_dot: false, allow_protocol_relative_urls: false, allow_fragments: true, allow_query_components: true, disallow_auth: false, validate_length: true }.require_protocol - if set to true isURL will return false if protocol is not present in the URL.require_valid_protocol - isURL will check if the URL's protocol is present in the protocols option.protocols - valid protocols can be modified with this option.require_host - if set to false isURL will not check if host is present in the URL.require_port - if set to true isURL will check if port is present in the URL.allow_protocol_relative_urls - if set to true protocol relative URLs will be allowed.allow_fragments - if set to false isURL will return false if fragments are present.allow_query_components - if set to false isURL will return false if query components are present.validate_length - if set to false isURL will skip string length validation (2083 characters is IE max URL length). isUUID(str [, version]) | check if the string is a UUID (version 1, 2, 3, 4 or 5). isVariableWidth(str) | check if the string contains a mixture of full and half-width chars. isVAT(str, countryCode) | check if the string is a valid VAT number if validation is available for the given country code matching ISO 3166-1 alpha-2. countryCode is one of ['AL', 'AR', 'AT', 'AU', 'BE', 'BG', 'BO', 'BR', 'BY', 'CA', 'CH', 'CL', 'CO', 'CR', 'CY', 'CZ', 'DE', 'DK', 'DO', 'EC', 'EE', 'EL', 'ES', 'FI', 'FR', 'GB', 'GT', 'HN', 'HR', 'HU', 'ID', 'IE', 'IL', 'IN', 'IS', 'IT', 'KZ', 'LT', 'LU', 'LV', 'MK', 'MT', 'MX', 'NG', 'NI', 'NL', 'NO', 'NZ', 'PA', 'PE', 'PH', 'PL', 'PT', 'PY', 'RO', 'RS', 'RU', 'SA', 'SE', 'SI', 'SK', 'SM', 'SV', 'TR', 'UA', 'UY', 'UZ', 'VE']. isWhitelisted(str, chars) | check if the string consists only of characters that appear in the whitelist chars. matches(str, pattern [, modifiers]) | check if the string matches the pattern.Either matches('foo', /foo/i) or matches('foo', 'foo', 'i').

Sanitizers

Here is a list of the sanitizers currently available.

Sanitizer | Description -------------------------------------- | ------------------------------- blacklist(input, chars) | remove characters that appear in the blacklist. The characters are used in a RegExp and so you will need to escape some chars, e.g. blacklist(input, '\\[\\]'). escape(input) | replace <, >, &, ', " and / with HTML entities. ltrim(input [, chars]) | trim characters from the left-side of the input. normalizeEmail(email [, options]) | canonicalize an email address. (This doesn't validate that the input is an email, if you want to validate the email use isEmail beforehand).options is an object with the following keys and default values:all_lowercase: true - Transforms the local part (before the @ symbol) of all email addresses to lowercase. Please note that this may violate RFC 5321, which gives providers the possibility to treat the local part of email addresses in a case sensitive way (although in practice most - yet not all - providers don't). The domain part of the email address is always lowercased, as it is case insensitive per RFC 1035.gmail_lowercase: true - Gmail addresses are known to be case-insensitive, so this switch allows lowercasing them even when all_lowercase is set to false. Please note that when all_lowercase is true, Gmail addresses are lowercased regardless of the value of this setting.gmail_remove_dots: true: Removes dots from the local part of the email address, as Gmail ignores them (e.g. "john.doe" and "johndoe" are considered equal).gmail_remove_subaddress: true: Normalizes addresses by removing "sub-addresses", which is the part following a "+" sign (e.g. "[email protected]" becomes "[email protected]").gmail_convert_googlemaildotcom: true: Converts addresses with domain @googlemail.com to @gmail.com, as they're equivalent.outlookdotcom_lowercase: true - Outlook.com addresses (including Windows Live and Hotmail) are known to be case-insensitive, so this switch allows lowercasing them even when all_lowercase is set to false. Please note that when all_lowercase is true, Outlook.com addresses are lowercased regardless of the value of this setting.outlookdotcom_remove_subaddress: true: Normalizes addresses by removing "sub-addresses", which is the part following a "+" sign (e.g. "[email protected]" becomes "[email protected]").yahoo_lowercase: true - Yahoo Mail addresses are known to be case-insensitive, so this switch allows lowercasing them even when all_lowercase is set to false. Please note that when all_lowercase is true, Yahoo Mail addresses are lowercased regardless of the value of this setting.yahoo_remove_subaddress: true: Normalizes addresses by removing "sub-addresses", which is the part following a "-" sign (e.g. "[email protected]" becomes "[email protected]").icloud_lowercase: true - iCloud addresses (including MobileMe) are known to be case-insensitive, so this switch allows lowercasing them even when all_lowercase is set to false. Please note that when all_lowercase is true, iCloud addresses are lowercased regardless of the value of this setting.icloud_remove_subaddress: true: Normalizes addresses by removing "sub-addresses", which is the part following a "+" sign (e.g. "[email protected]" becomes "[email protected]"). rtrim(input [, chars]) | trim characters from the right-side of the input. stripLow(input [, keep_new_lines]) | remove characters with a numerical value < 32 and 127, mostly control characters. If keep_new_lines is true, newline characters are preserved (\n and \r, hex 0xA and 0xD). Unicode-safe in JavaScript. toBoolean(input [, strict]) | convert the input string to a boolean. Everything except for '0', 'false' and '' returns true. In strict mode only '1' and 'true' return true. toDate(input) | convert the input string to a date, or null if the input is not a date. toFloat(input) | convert the input string to a float, or NaN if the input is not a float. toInt(input [, radix]) | convert the input string to an integer, or NaN if the input is not an integer. trim(input [, chars]) | trim characters (whitespace by default) from both sides of the input. unescape(input) | replace HTML encoded entities with <, >, &, ', " and /. whitelist(input, chars) | remove characters that do not appear in the whitelist. The characters are used in a RegExp and so you will need to escape some chars, e.g. whitelist(input, '\\[\\]').

XSS Sanitization

XSS sanitization was removed from the library in 2d5d6999.

For an alternative, have a look at Yahoo's xss-filters library or at DOMPurify.

Contributing

In general, we follow the "fork-and-pull" Git workflow.

  1. Fork the repo on GitHub
  2. Clone the project to your own machine
  3. Work on your fork
    1. Make your changes and additions
      • Most of your changes should be focused on src/ and test/ folders and/or README.md.
      • Files such as @teamteanpm2024/natus-eos-pariatur.js, @teamteanpm2024/natus-eos-pariatur.min.js and files in lib/ folder are autogenerated when running tests (npm test) and need not to be changed manually.
    2. Change or add tests if needed
    3. Run tests and make sure they pass
    4. Add changes to README.md if needed
  4. Commit changes to your own branch
  5. Make sure you merge the latest from "upstream" and resolve conflicts if there is any
  6. Repeat step 3(3) above
  7. Push your work back up to your fork
  8. Submit a Pull request so that we can review your changes

Tests

Tests are using mocha, to run the tests use:

$ npm test

Maintainers

Reading

Remember, validating can be troublesome sometimes. See A list of articles about programming assumptions commonly made that aren't true.

License (MIT)

Copyright (c) 2018 Chris O'Hara <[email protected]>

Permission is hereby granted, free of charge, to any person obtaining
a copy of this software and associated documentation files (the
"Software"), to deal in the Software without restriction, including
without limitation the rights to use, copy, modify, merge, publish,
distribute, sublicense, and/or sell copies of the Software, and to
permit persons to whom the Software is furnished to do so, subject to
the following conditions:

The above copyright notice and this permission notice shall be
included in all copies or substantial portions of the Software.

THE SOFTWARE IS PROVIDED "AS IS", WITHOUT WARRANTY OF ANY KIND,
EXPRESS OR IMPLIED, INCLUDING BUT NOT LIMITED TO THE WARRANTIES OF
MERCHANTABILITY, FITNESS FOR A PARTICULAR PURPOSE AND
NONINFRINGEMENT. IN NO EVENT SHALL THE AUTHORS OR COPYRIGHT HOLDERS BE
LIABLE FOR ANY CLAIM, DAMAGES OR OTHER LIABILITY, WHETHER IN AN ACTION
OF CONTRACT, TORT OR OTHERWISE, ARISING FROM, OUT OF OR IN CONNECTION
WITH THE SOFTWARE OR THE USE OR OTHER DEALINGS IN THE SOFTWARE.