npm package discovery and stats viewer.

Discover Tips

  • General search

    [free text search, go nuts!]

  • Package details

    pkg:[package-name]

  • User packages

    @[username]

Sponsor

Optimize Toolset

I’ve always been into building performant and accessible sites, but lately I’ve been taking it extremely seriously. So much so that I’ve been building a tool to help me optimize and monitor the sites that I build to make sure that I’m making an attempt to offer the best experience to those who visit them. If you’re into performant, accessible and SEO friendly sites, you might like it too! You can check it out at Optimize Toolset.

About

Hi, 👋, I’m Ryan Hefner  and I built this site for me, and you! The goal of this site was to provide an easy way for me to check the stats on my npm packages, both for prioritizing issues and updates, and to give me a little kick in the pants to keep up on stuff.

As I was building it, I realized that I was actually using the tool to build the tool, and figured I might as well put this out there and hopefully others will find it to be a fast and useful way to search and browse npm packages as I have.

If you’re interested in other things I’m working on, follow me on Twitter or check out the open source projects I’ve been publishing on GitHub.

I am also working on a Twitter bot for this site to tweet the most popular, newest, random packages from npm. Please follow that account now and it will start sending out packages soon–ish.

Open Software & Tools

This site wouldn’t be possible without the immense generosity and tireless efforts from the people who make contributions to the world and share their work via open source initiatives. Thank you 🙏

© 2024 – Pkg Stats / Ryan Hefner

@tap-payments/benefit-pay-button

v1.0.20

Published

just for wrapping benefit pay button to be used in react

Downloads

284

Vulnerabilities

Powered byPowered by Snyk
  • 0High
  • 0Medium
  • 0Low

Links

Maintainers

a.safwat-tapa.safwat-tapsherifashraftapsherifashraftapmostafaabobakr.tapmostafaabobakr.tapi.mousai.mousamahmoudallammahmoudallamaya_tapaya_tapmud_fahmimud_fahmiahmedkaram-tapahmedkaram-taphaitham-taphaitham-tapmuhammadazhar007muhammadazhar007elsharkawyelsharkawywaqastwaqasthala.qhala.qreham_alsabbaghreham_alsabbaghkalpanatapkalpanatapsadbarkhattaksadbarkhattak

Keywords

Readme

benefit-pay-button

Handling Benefit Pay button in React and vanilla JS

Install

This is a React module available through the npm registry. Installation is done using the npm install command:

npm install @tap-payments/Benefit-pay-button

---------------------------- OR -------------------------

yarn add @tap-payments/Benefit-pay-button

Get your keys

You can always use the example keys within our example app, but we do recommend you to head to our onboarding page. You will need to register your domain to get your Key.

Documentation

Please find all the documentation needed through our Tap official Docs.