npm package discovery and stats viewer.

Discover Tips

  • General search

    [free text search, go nuts!]

  • Package details

    pkg:[package-name]

  • User packages

    @[username]

Sponsor

Optimize Toolset

I’ve always been into building performant and accessible sites, but lately I’ve been taking it extremely seriously. So much so that I’ve been building a tool to help me optimize and monitor the sites that I build to make sure that I’m making an attempt to offer the best experience to those who visit them. If you’re into performant, accessible and SEO friendly sites, you might like it too! You can check it out at Optimize Toolset.

About

Hi, 👋, I’m Ryan Hefner  and I built this site for me, and you! The goal of this site was to provide an easy way for me to check the stats on my npm packages, both for prioritizing issues and updates, and to give me a little kick in the pants to keep up on stuff.

As I was building it, I realized that I was actually using the tool to build the tool, and figured I might as well put this out there and hopefully others will find it to be a fast and useful way to search and browse npm packages as I have.

If you’re interested in other things I’m working on, follow me on Twitter or check out the open source projects I’ve been publishing on GitHub.

I am also working on a Twitter bot for this site to tweet the most popular, newest, random packages from npm. Please follow that account now and it will start sending out packages soon–ish.

Open Software & Tools

This site wouldn’t be possible without the immense generosity and tireless efforts from the people who make contributions to the world and share their work via open source initiatives. Thank you 🙏

© 2024 – Pkg Stats / Ryan Hefner

@segment/snippet

v5.2.1

Published

Templating methods for rendering the analytics.js snippet.

Downloads

358,925

Maintainers

yshkpryshkprpriyanshispriyanshisjbasiglio-segmentjbasiglio-segmentpraguptapraguptasbhodiwalsbhodiwalsahilsharma0709sahilsharma0709farhan0581farhan0581jkusa_segmentjkusa_segmentharksinghharksingharjunbhandagearjunbhandagey.yuy.yuslenin-twilioslenin-twilioskondamuriskondamurinithan-twilionithan-twiliopraveenugiripraveenugiribnakkinabnakkinahema-bahirwani-segmenthema-bahirwani-segmentsandhya16sandhya16nemery-segmentnemery-segmentighorelaighorelamansarimansaribhavanki-segmentbhavanki-segmentar7devar7devvaibhavnandavaibhavnandanikumarsegmentnikumarsegmentitsarijitrayitsarijitrayssunejassunejaazhaotwilioazhaotwilioldelossantosldelossantoscjo2cjo2achandrashekaranachandrashekaranaparna.singhalaparna.singhalynguyenynguyentimmyzsearcytimmyzsearcyigracheva-twilioigracheva-twilioyashnit-segmentyashnit-segmentnanotimmnanotimmsrivig21srivig21chenchensegmentcomchenchensegmentcomsanket.mishrasanket.mishralweimersegmentlweimersegmentrcheedhallarcheedhallajxin_twiliojxin_twilioodoren_segmentodoren_segmentaditi.raveeshaditi.raveeshdltnbrks-segmentdltnbrks-segmentsai-patanjalisai-patanjalihimanshuphhimanshuphalecjacobs-segmentalecjacobs-segmentsshaikh_segmentsshaikh_segmentjohn.lee1100john.lee1100dazu70dazu70brian.aguirrebrian.aguirrepooja.patilpooja.patilsegment_fansegment_fannlubchenconlubchencojsh-wujsh-wunithin-bennynithin-bennypoojasegmentpoojasegmentebru.odokebru.odokbannapplebannapplerodhilton_twiliorodhilton_twilioguthriesegmentguthriesegmentsrishti-nemasrishti-nemacdelaomartinezcdelaomartinezmiguelpdiaz8miguelpdiaz8sundareswar.jayakumarsundareswar.jayakumargbatragbatraspencerattickspencerattickakodankiryakodankirynanette.ranesnanette.ranesgsolis_segmentgsolis_segmentnitinpm432nitinpm432amigandhiamigandhisegmentseansegmentseanhmohanram_seghmohanram_segjrupasinghejrupasinghedevthaledevthalesmccoy-twiliosmccoy-twilioseg-leonelsanchesseg-leonelsanchesjibrangjibrangsethgrid_segmentsethgrid_segmentlight-bringer-blrlight-bringer-blraubreysineaubreysineed-twilion-npmed-twilion-npmharsh-joshi99harsh-joshi99irfan.ali.segmentirfan.ali.segmentkbhargavaram-sgkbhargavaram-sgneedcaffeineneedcaffeinenat-gridnat-gridwlumsegmentwlumsegmentmoyara2moyara2bala.singareddybala.singareddyakash.gautam07akash.gautam07preetyppreetypviveksainaneesegmentviveksainaneesegmentmsarafmsarafkjoerreskjoerresrokatyalrokatyalainatancincoainatancincoanton-vylushchakanton-vylushchaksowjanyasegmentsowjanyasegmentalayvoraalayvoratw-dgarciatw-dgarciaparag.pandaparag.pandablangtwilioblangtwilioryanrouleau-segmentryanrouleau-segmenttwjosiahtwjosiahmcullenmeyermcullenmeyerdavid.anusontarangkul.segmentdavid.anusontarangkul.segmentmckern_segmentmckern_segmentsegment-adminsegment-adminnainy.agrawalnainy.agrawaltdibaccotdibaccosudojatinsudojatinnageshgolemnageshgolembrandonheyer-segmentbrandonheyer-segmentalfrimpongalfrimpongdobrin.ganevdobrin.ganevankit.gupta.unthinkableankit.gupta.unthinkablemarinheromarinherobenattwiliobenattwiliobharath.boregowdabharath.boregowdaconniechenconniechensungju.jinsungju.jinpooyajpooyajyli119yli119ea_segmentea_segmentemilyjiaemilyjiakx-segmentkx-segmentxinghao.huangxinghao.huangharsh.vardhanharsh.vardhanjoe.ayoub.segmentjoe.ayoub.segmentgkochar123gkochar123rollcoderollcodeariel.silvestriariel.silvestricherylj-segmentcherylj-segmentimmanojimmanojaaronklishaaronklishmichelrmichelrmaneesh.dharma29maneesh.dharma29brianhumphreystwiliobrianhumphreystwiliojfehrman.segmentjfehrman.segmentjoetessyjoetessypmuninpmuninjalexy12jalexy12jbandi-twiliojbandi-twilioprayansh-twilioprayansh-twiliodominicbarnesdominicbarnesbrandon.scott-segmentbrandon.scott-segmentbgillanbgillanphillip.thomasphillip.thomasricardo.rossiricardo.rossiforgetfulfellowforgetfulfellowfauzy.yyfauzy.yymayur-pitalemayur-pitaledbaik-twilio-segmentdbaik-twilio-segmentseg-rustybaileyseg-rustybaileytanya.gupta.segmenttanya.gupta.segmentpmiller-twiliopmiller-twilionevermore2022nevermore2022aishikawakiaishikawakicsayusocsayusomcoulibalimcoulibalishupadhyayshupadhyayjahood-twiliojahood-twiliosaisagarkappaganthulasaisagarkappaganthularmukundanrmukundanarubiochavezarubiochavezshuvrajit9904shuvrajit9904s3gm3nts3gm3ntama0223ama0223tbrennanjtbrennanjdangmai-segmentdangmai-segmentshraddha-twilioshraddha-twiliosa-jsootersa-jsooterenyi.asonyeenyi.asonyeafsha-nazim-segafsha-nazim-segmschaszbergermschaszbergerlnambalnambavaradarajan-twvaradarajan-twseanhan-segmentseanhan-segmentreplateroreplaterosayan-das-insayan-das-injusteenjusteenjgabe13jgabe13meg1000meg1000funlufunluashwitha.bgashwitha.bgwhaider_twiliowhaider_twiliotcgilberttcgilbertkevinburkesegmentkevinburkesegmentfelttripfelttripprabhnoor1997prabhnoor1997akashyap91akashyap91clintz.segclintz.segkarimkeshwanikarimkeshwaniwally.tgwally.tgrhall-twiliorhall-twilioyash-twilioyash-twiliobrookstaylorjrbrookstaylorjrshayan-golafshanishayan-golafshanilerahulramlerahulrammugelstadmugelstadrrivera-segmentrrivera-segmentsethnutetwiliosethnutetwiliomanali-bhosalemanali-bhosalechtoombschtoombssethsegmentsethsegmenteric-hydeeric-hydeelmoselyeeelmoselyeemichaelghsegmichaelghsegjayakrishnannairjayakrishnannairlateefatlateefatmaryam.sharifmaryam.sharifwdbettswdbettsryanligonryanligonsindhusegmentsindhusegmentlfdelossantoslfdelossantosaramakrishnanaramakrishnanvbatanovvbatanovlluque-twiliolluque-twiliojair.avilesjair.avilespmaidpmaidsong4yousong4youpeterdemartinipeterdemartiniemmy.byrneemmy.byrnevincen7tranvincen7trandean-huynhdean-huynhcdignam-segmentcdignam-segmentabhinavsurekaabhinavsurekaarunlalam-segmentarunlalam-segmentneeharikakondipatineeharikakondipatisimpixelatedsimpixelatedchihchun-twiliochihchun-twilioacharles14acharles14jyim008jyim008fhalim-segmentfhalim-segmentcfreecfreehjoonpmhjoonpmceline-segmentceline-segmentpmcanseco-segmentpmcanseco-segmentmasiramasiraamillet89amillet89cholt002cholt002av-segmentav-segmentaghotikaraghotikarvikrant-segmentvikrant-segmentlarryatsegmentlarryatsegmentscruwys1scruwys1kyliepedersenkyliepedersenjinaparkjinaparksegmentiosegmentiorajulvaderarajulvaderalpediredlalpediredlan2parkon2parkotyson_segmenttyson_segmentbgamwellbgamwellsalolivaressalolivareserikdwerikdwchenxiangzhangchenxiangzhangmericssonmericssonprayansh-segmenttprayansh-segmenttjeremylarkinjeremylarkinbsneedbsneeddanieljackinsdanieljackinssegment-sethsegment-sethjames9446james9446priscilla.giattipriscilla.giattinlsunnlsundrew-thompsondrew-thompsonsegment-jsinghsegment-jsinghandrius-segmentandrius-segmentvalerieernstvalerieernstgilomergilomermarcelopvmarcelopveric.rognereric.rognerkdharaiyakdharaiyajon.anderson-at-segment.comjon.anderson-at-segment.comstacy.songstacy.songrexatsegmentrexatsegmentnickaguilarnickaguilarbradenbeckerbradenbeckerreneewangreneewangdan.laskydan.laskysam.tapiasam.tapiavikramkumar19vikramkumar19mpriyad25mpriyad25jeremy.parkerjeremy.parkersmidgessmidges

Keywords

Readme

@segment/snippet

Render the analytics.js snippet.

The recommended way to use analytics.js is to follow the analytics.js quickstart guide. If you absolutely need to generate a snippet dynamically, this is an alternate solution. Note that when using this in-browser, the global analytics object will not be defined until the snippet is rendered and executed.

For information on browser support, see: https://segment.com/docs/connections/sources/catalog/libraries/website/javascript/supported-browsers/

Installation

# npm
npm install @segment/snippet

# yarn
yarn add @segment/snippet

# pnpm
pnpm add @segment/snippet

Example

const snippet = require('@segment/snippet');

const contents = snippet.max({
  host: 'cdn.segment.com',
  apiKey: '03fwkuu3',
  page: {
    category: 'Docs',
    name: 'Integrations',
    properties: {
      foo: 'bar'
    }
  }
});

API

snippet.max(options)

Returns the maxified version of the analytics.js snippet given a set of options:

  • host: the domain name where the analytics.js script is hosted.
  • useHostForBundles: If set to true, the snippet will include the _cdn property to tell analytics.js where to fetch bundles from.
  • apiKey: the apiKey to load in the snippet.
  • page: the options to pass to analytics.page. if page is false, then the page() call will be omitted.
  • load: If object, these are the settings passed as the second argument to analytics.load. This can be useful if you want to override Segment.io integration behavior, or if you want dynamically control which integraions load on the client-side for things like GDPR. If set to false the load() call will be omitted.
  • ajsPath: override the default analytics.min.js location

snippet.min(options)

Returns the minified version of the snippet.

Development

Installation + QA

nvm use
yarn install
make lint
make test

Running tests in Saucelabs

SAUCE=true make test

Releasing

  1. Publish to npm
git checkout master && git pull --ff-only
npm version <patch|minor|major>
git push --follow-tags
make build
npm publish
  1. Create a new github release.

  2. Bump package version on segmentio/app.

  3. Update all example snippets on public docs repo via search + replace

  • Get example snippet by runnings yarn fixture and observing generated tmp.fixture.*.js files.
  • Tip: double-check that the fixture's SNIPPET_VERSION refers to the new npm version.