npm package discovery and stats viewer.

Discover Tips

  • General search

    [free text search, go nuts!]

  • Package details

    pkg:[package-name]

  • User packages

    @[username]

Sponsor

Optimize Toolset

I’ve always been into building performant and accessible sites, but lately I’ve been taking it extremely seriously. So much so that I’ve been building a tool to help me optimize and monitor the sites that I build to make sure that I’m making an attempt to offer the best experience to those who visit them. If you’re into performant, accessible and SEO friendly sites, you might like it too! You can check it out at Optimize Toolset.

About

Hi, 👋, I’m Ryan Hefner  and I built this site for me, and you! The goal of this site was to provide an easy way for me to check the stats on my npm packages, both for prioritizing issues and updates, and to give me a little kick in the pants to keep up on stuff.

As I was building it, I realized that I was actually using the tool to build the tool, and figured I might as well put this out there and hopefully others will find it to be a fast and useful way to search and browse npm packages as I have.

If you’re interested in other things I’m working on, follow me on Twitter or check out the open source projects I’ve been publishing on GitHub.

I am also working on a Twitter bot for this site to tweet the most popular, newest, random packages from npm. Please follow that account now and it will start sending out packages soon–ish.

Open Software & Tools

This site wouldn’t be possible without the immense generosity and tireless efforts from the people who make contributions to the world and share their work via open source initiatives. Thank you 🙏

© 2024 – Pkg Stats / Ryan Hefner

@segment/cross-fetch

v4.2.0

Published

Universal WHATWG Fetch API for Node, Browsers and React Native

Downloads

42

Maintainers

y.yuy.yuslenin-twilioslenin-twilioskondamuriskondamurinithan-twilionithan-twiliopraveenugiripraveenugiribnakkinabnakkinahema-bahirwani-segmenthema-bahirwani-segmentsandhya16sandhya16nemery-segmentnemery-segmentighorelaighorelamansarimansaribhavanki-segmentbhavanki-segmentar7devar7devvaibhavnandavaibhavnandanikumarsegmentnikumarsegmentitsarijitrayitsarijitrayssunejassunejaazhaotwilioazhaotwilioldelossantosldelossantoscjo2cjo2achandrashekaranachandrashekaranaparna.singhalaparna.singhalynguyenynguyentimmyzsearcytimmyzsearcyigracheva-twilioigracheva-twilioyashnit-segmentyashnit-segmentnanotimmnanotimmsrivig21srivig21chenchensegmentcomchenchensegmentcomsanket.mishrasanket.mishralweimersegmentlweimersegmentrcheedhallarcheedhallajxin_twiliojxin_twilioodoren_segmentodoren_segmentaditi.raveeshaditi.raveeshdltnbrks-segmentdltnbrks-segmentsai-patanjalisai-patanjalihimanshuphhimanshuphalecjacobs-segmentalecjacobs-segmentsshaikh_segmentsshaikh_segmentjohn.lee1100john.lee1100dazu70dazu70brian.aguirrebrian.aguirrepooja.patilpooja.patilsegment_fansegment_fannlubchenconlubchencojsh-wujsh-wunithin-bennynithin-bennypoojasegmentpoojasegmentebru.odokebru.odokbannapplebannapplerodhilton_twiliorodhilton_twilioguthriesegmentguthriesegmentsrishti-nemasrishti-nemacdelaomartinezcdelaomartinezmiguelpdiaz8miguelpdiaz8sundareswar.jayakumarsundareswar.jayakumargbatragbatraspencerattickspencerattickakodankiryakodankirynanette.ranesnanette.ranesgsolis_segmentgsolis_segmentnitinpm432nitinpm432aadityabhatt10aadityabhatt10amigandhiamigandhisegmentseansegmentseanhmohanram_seghmohanram_segjrupasinghejrupasinghedevthaledevthalesmccoy-twiliosmccoy-twilioseg-leonelsanchesseg-leonelsanchesjibrangjibrangsethgrid_segmentsethgrid_segmentlight-bringer-blrlight-bringer-blraubreysineaubreysineed-twilion-npmed-twilion-npmharsh-joshi99harsh-joshi99irfan.ali.segmentirfan.ali.segmentkbhargavaram-sgkbhargavaram-sgneedcaffeineneedcaffeinenat-gridnat-gridwlumsegmentwlumsegmentmoyara2moyara2bala.singareddybala.singareddygbbastosgbbastosakash.gautam07akash.gautam07preetyppreetypviveksainaneesegmentviveksainaneesegmentmsarafmsarafkjoerreskjoerresrokatyalrokatyalainatancincoainatancincoanton-vylushchakanton-vylushchaksowjanyasegmentsowjanyasegmentalayvoraalayvoramsaunders-segmentmsaunders-segmenttw-dgarciatw-dgarciaparag.pandaparag.pandablangtwilioblangtwilioryanrouleau-segmentryanrouleau-segmenttwjosiahtwjosiahmcullenmeyermcullenmeyerdavid.anusontarangkul.segmentdavid.anusontarangkul.segmentmckern_segmentmckern_segmentsegment-adminsegment-adminnainy.agrawalnainy.agrawaltdibaccotdibaccosudojatinsudojatinnageshgolemnageshgolembrandonheyer-segmentbrandonheyer-segmentalfrimpongalfrimpongdobrin.ganevdobrin.ganevankit.gupta.unthinkableankit.gupta.unthinkablemarinheromarinherobenattwiliobenattwiliobharath.boregowdabharath.boregowdaconniechenconniechensungju.jinsungju.jinpooyajpooyajyli119yli119ea_segmentea_segmentemilyjiaemilyjiakx-segmentkx-segmentxinghao.huangxinghao.huangharsh.vardhanharsh.vardhanjoe.ayoub.segmentjoe.ayoub.segmentgkochar123gkochar123rollcoderollcodeariel.silvestriariel.silvestricherylj-segmentcherylj-segmentimmanojimmanojaaronklishaaronklishmichelrmichelrmaneesh.dharma29maneesh.dharma29brianhumphreystwiliobrianhumphreystwiliojfehrman.segmentjfehrman.segmentjoetessyjoetessypmuninpmuninjalexy12jalexy12jbandi-twiliojbandi-twilioprayansh-twilioprayansh-twiliodominicbarnesdominicbarnesbrandon.scott-segmentbrandon.scott-segmentbgillanbgillanphillip.thomasphillip.thomasricardo.rossiricardo.rossiforgetfulfellowforgetfulfellowfauzy.yyfauzy.yymayur-pitalemayur-pitaledbaik-twilio-segmentdbaik-twilio-segmentseg-rustybaileyseg-rustybaileytanya.gupta.segmenttanya.gupta.segmentpmiller-twiliopmiller-twilionevermore2022nevermore2022aishikawakiaishikawakicsayusocsayusomcoulibalimcoulibalishupadhyayshupadhyayjahood-twiliojahood-twiliosaisagarkappaganthulasaisagarkappaganthularmukundanrmukundanarubiochavezarubiochavezshuvrajit9904shuvrajit9904s3gm3nts3gm3ntama0223ama0223tbrennanjtbrennanjdangmai-segmentdangmai-segmentshraddha-twilioshraddha-twiliosa-jsootersa-jsooterenyi.asonyeenyi.asonyeafsha-nazim-segafsha-nazim-segmschaszbergermschaszbergerlnambalnambavaradarajan-twvaradarajan-twseanhan-segmentseanhan-segmentreplateroreplaterosayan-das-insayan-das-injusteenjusteenjgabe13jgabe13meg1000meg1000funlufunluashwitha.bgashwitha.bgwhaider_twiliowhaider_twiliotcgilberttcgilbertkevinburkesegmentkevinburkesegmentfelttripfelttripprabhnoor1997prabhnoor1997akashyap91akashyap91clintz.segclintz.segkarimkeshwanikarimkeshwaniwally.tgwally.tgrhall-twiliorhall-twilioyash-twilioyash-twiliobrookstaylorjrbrookstaylorjrshayan-golafshanishayan-golafshanilerahulramlerahulrammugelstadmugelstadrrivera-segmentrrivera-segmentsethnutetwiliosethnutetwiliomanali-bhosalemanali-bhosalechtoombschtoombssethsegmentsethsegmenteric-hydeeric-hydeelmoselyeeelmoselyeemichaelghsegmichaelghsegjayakrishnannairjayakrishnannairlateefatlateefatmaryam.sharifmaryam.sharifwdbettswdbettsryanligonryanligonsindhusegmentsindhusegmentlfdelossantoslfdelossantosaramakrishnanaramakrishnanvbatanovvbatanovlluque-twiliolluque-twiliojair.avilesjair.avilespmaidpmaidsong4yousong4youpeterdemartinipeterdemartiniemmy.byrneemmy.byrnevincen7tranvincen7trandean-huynhdean-huynhcdignam-segmentcdignam-segmentabhinavsurekaabhinavsurekaarunlalam-segmentarunlalam-segmentneeharikakondipatineeharikakondipatisimpixelatedsimpixelatedchihchun-twiliochihchun-twilioacharles14acharles14jyim008jyim008fhalim-segmentfhalim-segmentcfreecfreehjoonpmhjoonpmceline-segmentceline-segmentpmcanseco-segmentpmcanseco-segmentmasiramasiraamillet89amillet89cholt002cholt002av-segmentav-segmentaghotikaraghotikarvikrant-segmentvikrant-segmentlarryatsegmentlarryatsegmentscruwys1scruwys1kyliepedersenkyliepedersenjinaparkjinaparksegmentiosegmentiorajulvaderarajulvaderalpediredlalpediredlan2parkon2parkotyson_segmenttyson_segmentbgamwellbgamwellsalolivaressalolivareserikdwerikdwchenxiangzhangchenxiangzhangmericssonmericssonprayansh-segmenttprayansh-segmenttjeremylarkinjeremylarkinbsneedbsneeddanieljackinsdanieljackinssegment-sethsegment-sethjames9446james9446priscilla.giattipriscilla.giattinlsunnlsundrew-thompsondrew-thompsonsegment-jsinghsegment-jsinghandrius-segmentandrius-segmentvalerieernstvalerieernstkelcookkelcookgilomergilomermarcelopvmarcelopveric.rognereric.rognerkdharaiyakdharaiyajon.anderson-at-segment.comjon.anderson-at-segment.comstacy.songstacy.songrexatsegmentrexatsegmentnickaguilarnickaguilarbradenbeckerbradenbeckerreneewangreneewangdan.laskydan.laskysam.tapiasam.tapiavikramkumar19vikramkumar19mpriyad25mpriyad25jeremy.parkerjeremy.parkersmidgessmidges

Readme

cross-fetch NPM Version Downloads Per Week License: MIT CI codecov

Universal WHATWG Fetch API for Node, Browsers and React Native. The scenario that cross-fetch really shines is when the same JavaScript codebase needs to run on different platforms.

  • Platform agnostic: browsers, Node or React Native
  • Optional polyfill: it's up to you if something is going to be added to the global object or not
  • Simple interface: no instantiation, no configuration and no extra dependency
  • WHATWG compliant: it works the same way wherever your code runs
  • TypeScript support: better development experience with types.

Table of Contents


Install

npm install --save cross-fetch

As a ponyfill:

// Using ES6 modules with Babel or TypeScript
import fetch from 'cross-fetch';

// Using CommonJS modules
const fetch = require('cross-fetch');

As a polyfill:

// Using ES6 modules
import 'cross-fetch/polyfill';

// Using CommonJS modules
require('cross-fetch/polyfill');

The CDN build is also available on unpkg:

<script src="//unpkg.com/cross-fetch/dist/cross-fetch.js"></script>

This adds the fetch function to the window object. Note that this is not UMD compatible.


Usage

With promises:

import fetch from 'cross-fetch';
// Or just: import 'cross-fetch/polyfill';

fetch('//api.github.com/users/lquixada')
  .then(res => {
    if (res.status >= 400) {
      throw new Error("Bad response from server");
    }
    return res.json();
  })
  .then(user => {
    console.log(user);
  })
  .catch(err => {
    console.error(err);
  });

With async/await:

import fetch from 'cross-fetch';
// Or just: import 'cross-fetch/polyfill';

(async () => {
  try {
    const res = await fetch('//api.github.com/users/lquixada');
    
    if (res.status >= 400) {
      throw new Error("Bad response from server");
    }
    
    const user = await res.json();
  
    console.log(user);
  } catch (err) {
    console.error(err);
  }
})();

⚠️ Warning: If you're in an environment that doesn't support Promises such as Internet Explorer, you must install an ES6 Promise compatible polyfill. es6-promise is suggested.

Demo & API

You can find a comprehensive doc at Github's fetch page. If you want to play with cross-fetch, check our JSFiddle playground.

Tip: Run the fiddle on various browsers and with different settings (for instance: cross-domain requests, wrong urls or text requests). Don't forget to open the console in the test suite page and play around.

FAQ

Yet another fetch library?

I did a lot of research in order to find a fetch library that could be simple, cross-platform and provide polyfill as an option. There's a plethora of libs out there but none could match those requirements.

Why not isomorphic-fetch?

My preferred library used to be isomorphic-fetch but it has this bug that prevents it from running in a react native environment. It seems unlikely to be fixed since there haven't been any new commits to it since 2016. That means dependencies are outdated as well.

Why polyfill might not be a good idea?

In a word? Risk. If the spec changes in the future, it might be problematic to debug. Read more about it on sindresorhus's ponyfill page. It's up to you if you're fine with it or not.

How does cross-fetch work?

Just like isomorphic-fetch, it is just a proxy. If you're in node, it delivers you the node-fetch library, if you're in a browser or React Native, it delivers you the github's whatwg-fetch. The same strategy applies whether you're using polyfill or ponyfill.

Who's Using It?

|The New York Times|Apollo GraphQL|Facebook|Swagger|VulcanJS|graphql-request| |:---:|:---:|:---:|:---:|:---:|:---:| |The New York Times|Apollo GraphQL|Facebook|Swagger|VulcanJS|graphql-request|

Thanks

Heavily inspired by the works of matthew-andrews. Kudos to him!

License

cross-fetch is licensed under the MIT license © Leonardo Quixadá

Author

|@lquixada| |:---:| |@lquixada|