npm package discovery and stats viewer.

Discover Tips

  • General search

    [free text search, go nuts!]

  • Package details

    pkg:[package-name]

  • User packages

    @[username]

Sponsor

Optimize Toolset

I’ve always been into building performant and accessible sites, but lately I’ve been taking it extremely seriously. So much so that I’ve been building a tool to help me optimize and monitor the sites that I build to make sure that I’m making an attempt to offer the best experience to those who visit them. If you’re into performant, accessible and SEO friendly sites, you might like it too! You can check it out at Optimize Toolset.

About

Hi, 👋, I’m Ryan Hefner  and I built this site for me, and you! The goal of this site was to provide an easy way for me to check the stats on my npm packages, both for prioritizing issues and updates, and to give me a little kick in the pants to keep up on stuff.

As I was building it, I realized that I was actually using the tool to build the tool, and figured I might as well put this out there and hopefully others will find it to be a fast and useful way to search and browse npm packages as I have.

If you’re interested in other things I’m working on, follow me on Twitter or check out the open source projects I’ve been publishing on GitHub.

I am also working on a Twitter bot for this site to tweet the most popular, newest, random packages from npm. Please follow that account now and it will start sending out packages soon–ish.

Open Software & Tools

This site wouldn’t be possible without the immense generosity and tireless efforts from the people who make contributions to the world and share their work via open source initiatives. Thank you 🙏

© 2024 – Pkg Stats / Ryan Hefner

@segment/backstage-plugin-proxy-sigv4-backend

v0.3.2

Published

Backstage backend plugin that configures endpoints for signing and proxying HTTP requests with AWS SigV4

Downloads

1,222

Maintainers

apackerapackergaprabhugaprabhupoojapatilsegpoojapatilsegandwivediandwivedivikakumarvikakumaryshkpryshkprpriyanshispriyanshisjbasiglio-segmentjbasiglio-segmentpraguptapraguptasbhodiwalsbhodiwalsahilsharma0709sahilsharma0709farhan0581farhan0581jkusa_segmentjkusa_segmentharksinghharksingharjunbhandagearjunbhandagey.yuy.yuslenin-twilioslenin-twilioskondamuriskondamurinithan-twilionithan-twiliopraveenugiripraveenugiribnakkinabnakkinahema-bahirwani-segmenthema-bahirwani-segmentsandhya16sandhya16nemery-segmentnemery-segmentighorelaighorelamansarimansaribhavanki-segmentbhavanki-segmentar7devar7devvaibhavnandavaibhavnandanikumarsegmentnikumarsegmentitsarijitrayitsarijitrayssunejassunejaazhaotwilioazhaotwilioldelossantosldelossantoscjo2cjo2achandrashekaranachandrashekaranaparna.singhalaparna.singhalynguyenynguyentimmyzsearcytimmyzsearcyigracheva-twilioigracheva-twilioyashnit-segmentyashnit-segmentnanotimmnanotimmsrivig21srivig21chenchensegmentcomchenchensegmentcomsanket.mishrasanket.mishralweimersegmentlweimersegmentrcheedhallarcheedhallajxin_twiliojxin_twilioodoren_segmentodoren_segmentaditi.raveeshaditi.raveeshdltnbrks-segmentdltnbrks-segmentsai-patanjalisai-patanjalihimanshuphhimanshuphalecjacobs-segmentalecjacobs-segmentsshaikh_segmentsshaikh_segmentjohn.lee1100john.lee1100dazu70dazu70brian.aguirrebrian.aguirrepooja.patilpooja.patilsegment_fansegment_fannlubchenconlubchencojsh-wujsh-wunithin-bennynithin-bennypoojasegmentpoojasegmentebru.odokebru.odokbannapplebannapplerodhilton_twiliorodhilton_twilioguthriesegmentguthriesegmentsrishti-nemasrishti-nemacdelaomartinezcdelaomartinezmiguelpdiaz8miguelpdiaz8sundareswar.jayakumarsundareswar.jayakumargbatragbatraspencerattickspencerattickakodankiryakodankirynanette.ranesnanette.ranesgsolis_segmentgsolis_segmentnitinpm432nitinpm432amigandhiamigandhisegmentseansegmentseanhmohanram_seghmohanram_segjrupasinghejrupasinghedevthaledevthalesmccoy-twiliosmccoy-twilioseg-leonelsanchesseg-leonelsanchesjibrangjibrangsethgrid_segmentsethgrid_segmentlight-bringer-blrlight-bringer-blraubreysineaubreysineed-twilion-npmed-twilion-npmharsh-joshi99harsh-joshi99irfan.ali.segmentirfan.ali.segmentkbhargavaram-sgkbhargavaram-sgneedcaffeineneedcaffeinenat-gridnat-gridwlumsegmentwlumsegmentmoyara2moyara2bala.singareddybala.singareddyakash.gautam07akash.gautam07preetyppreetypviveksainaneesegmentviveksainaneesegmentmsarafmsarafkjoerreskjoerresrokatyalrokatyalainatancincoainatancincoanton-vylushchakanton-vylushchaksowjanyasegmentsowjanyasegmentalayvoraalayvoratw-dgarciatw-dgarciaparag.pandaparag.pandablangtwilioblangtwilioryanrouleau-segmentryanrouleau-segmenttwjosiahtwjosiahmcullenmeyermcullenmeyerdavid.anusontarangkul.segmentdavid.anusontarangkul.segmentmckern_segmentmckern_segmentsegment-adminsegment-adminnainy.agrawalnainy.agrawaltdibaccotdibaccosudojatinsudojatinnageshgolemnageshgolembrandonheyer-segmentbrandonheyer-segmentalfrimpongalfrimpongdobrin.ganevdobrin.ganevankit.gupta.unthinkableankit.gupta.unthinkablemarinheromarinherobenattwiliobenattwiliobharath.boregowdabharath.boregowdaconniechenconniechensungju.jinsungju.jinpooyajpooyajyli119yli119ea_segmentea_segmentemilyjiaemilyjiakx-segmentkx-segmentxinghao.huangxinghao.huangharsh.vardhanharsh.vardhanjoe.ayoub.segmentjoe.ayoub.segmentgkochar123gkochar123rollcoderollcodeariel.silvestriariel.silvestricherylj-segmentcherylj-segmentimmanojimmanojaaronklishaaronklishmichelrmichelrmaneesh.dharma29maneesh.dharma29brianhumphreystwiliobrianhumphreystwiliojfehrman.segmentjfehrman.segmentjoetessyjoetessypmuninpmuninjalexy12jalexy12jbandi-twiliojbandi-twilioprayansh-twilioprayansh-twiliodominicbarnesdominicbarnesbrandon.scott-segmentbrandon.scott-segmentbgillanbgillanphillip.thomasphillip.thomasricardo.rossiricardo.rossiforgetfulfellowforgetfulfellowfauzy.yyfauzy.yymayur-pitalemayur-pitaledbaik-twilio-segmentdbaik-twilio-segmentseg-rustybaileyseg-rustybaileytanya.gupta.segmenttanya.gupta.segmentpmiller-twiliopmiller-twilionevermore2022nevermore2022aishikawakiaishikawakicsayusocsayusomcoulibalimcoulibalishupadhyayshupadhyayjahood-twiliojahood-twiliosaisagarkappaganthulasaisagarkappaganthularmukundanrmukundanarubiochavezarubiochavezshuvrajit9904shuvrajit9904s3gm3nts3gm3ntama0223ama0223tbrennanjtbrennanjdangmai-segmentdangmai-segmentshraddha-twilioshraddha-twiliosa-jsootersa-jsooterenyi.asonyeenyi.asonyeafsha-nazim-segafsha-nazim-segmschaszbergermschaszbergerlnambalnambavaradarajan-twvaradarajan-twseanhan-segmentseanhan-segmentreplateroreplaterosayan-das-insayan-das-injusteenjusteenjgabe13jgabe13meg1000meg1000funlufunluashwitha.bgashwitha.bgwhaider_twiliowhaider_twiliotcgilberttcgilbertkevinburkesegmentkevinburkesegmentfelttripfelttripprabhnoor1997prabhnoor1997akashyap91akashyap91clintz.segclintz.segkarimkeshwanikarimkeshwaniwally.tgwally.tgrhall-twiliorhall-twilioyash-twilioyash-twiliobrookstaylorjrbrookstaylorjrshayan-golafshanishayan-golafshanilerahulramlerahulrammugelstadmugelstadrrivera-segmentrrivera-segmentsethnutetwiliosethnutetwiliomanali-bhosalemanali-bhosalechtoombschtoombssethsegmentsethsegmenteric-hydeeric-hydeelmoselyeeelmoselyeemichaelghsegmichaelghsegjayakrishnannairjayakrishnannairlateefatlateefatmaryam.sharifmaryam.sharifwdbettswdbettsryanligonryanligonsindhusegmentsindhusegmentlfdelossantoslfdelossantosvbatanovvbatanovlluque-twiliolluque-twiliojair.avilesjair.avilespmaidpmaidsong4yousong4youpeterdemartinipeterdemartiniemmy.byrneemmy.byrnevincen7tranvincen7trandean-huynhdean-huynhcdignam-segmentcdignam-segmentabhinavsurekaabhinavsurekaarunlalam-segmentarunlalam-segmentneeharikakondipatineeharikakondipatisimpixelatedsimpixelatedchihchun-twiliochihchun-twilioacharles14acharles14jyim008jyim008fhalim-segmentfhalim-segmentcfreecfreehjoonpmhjoonpmceline-segmentceline-segmentpmcanseco-segmentpmcanseco-segmentmasiramasiraamillet89amillet89cholt002cholt002av-segmentav-segmentaghotikaraghotikarvikrant-segmentvikrant-segmentlarryatsegmentlarryatsegmentscruwys1scruwys1kyliepedersenkyliepedersenjinaparkjinaparksegmentiosegmentiorajulvaderarajulvaderalpediredlalpediredlan2parkon2parkotyson_segmenttyson_segmentbgamwellbgamwellsalolivaressalolivareserikdwerikdwchenxiangzhangchenxiangzhangmericssonmericssonprayansh-segmenttprayansh-segmenttjeremylarkinjeremylarkinbsneedbsneeddanieljackinsdanieljackinssegment-sethsegment-sethjames9446james9446priscilla.giattipriscilla.giattinlsunnlsundrew-thompsondrew-thompsonsegment-jsinghsegment-jsinghandrius-segmentandrius-segmentvalerieernstvalerieernstgilomergilomermarcelopvmarcelopveric.rognereric.rognerkdharaiyakdharaiyajon.anderson-at-segment.comjon.anderson-at-segment.comstacy.songstacy.songrexatsegmentrexatsegmentnickaguilarnickaguilarbradenbeckerbradenbeckerreneewangreneewangdan.laskydan.laskysam.tapiasam.tapiavikramkumar19vikramkumar19mpriyad25mpriyad25jeremy.parkerjeremy.parkersmidgessmidges

Keywords

Readme

AWS SigV4 Proxy backend plugin

Backend plugin that enables proxy definitions to be declared in, and read from, app-config.yaml (just like the built-in proxy-backend plugin) that will be signed using the AWS Signature Version 4 (SigV4) request-signing algorithm.

Loosely modeled after the official AWS SigV4 Proxy project (awslabs/aws-sigv4-proxy).

Getting started

This plugin has already been added to the Backstage app in this repository, meaning you'll be able to try out the plugin by firstly adding your Proxy Sigv4 Configuration to the app-config.yaml located in the root folder of this repository. After that, you should be able to access it by starting the app, and then navigating to /api/proxy-sigv4/*.

This backend plugin can also be started in a standalone mode via yarn start from within this package; however, it will have limited functionality and this process is most convenient when developing the plugin itself. If you develop using the standalone server, note that the plugin is mounted at the backend root and not under /api/: /proxy-sigv4/*.

Installation

Add the backend plugin as a dependency to packages/backend

yarn add --cwd packages/backend '@segment/backstage-plugin-proxy-sigv4-backend'

New Backend System

The AWS SigV4 Proxy backend plugin has support for the new backend system. In your packages/backend/src/index.ts file, make the following changes:

  import { createBackend } from '@backstage/backend-defaults';
  const backend = createBackend();
  // ... other feature additions

+ // proxy-sigv4 plugin installation
+ backend.add(import('@segment/backstage-plugin-proxy-sigv4-backend'));

  backend.start();

Legacy Backend System

Create a new backend plugin wrapper module

If you are still using the legacy backend system, you'll need to add the plugin to the router in your backend package.

You can do this by creating a file called packages/backend/src/plugins/proxy-sigv4.ts. Example content for proxy-sigv4.ts could be something like this.

// packages/backend/src/plugins/proxy-sigv4.ts

import { createRouter } from '@segment/backstage-plugin-proxy-sigv4-backend';
import { Router } from 'express';
import { PluginEnvironment } from '../types';

export default async function createPlugin({
  logger,
  config,
}: PluginEnvironment): Promise<Router> {
  return await createRouter({ logger, config });
}

Initialize the wrapper module and mount the router in packages/backend

With the proxy-sigv4.ts router setup in place, add the router to packages/backend/src/index.ts:

 // packages/backend/src/index.ts

+import proxySigV4 from './plugins/proxy-sigv4';

 async function main() {
   ...
   const createEnv = makeCreateEnv(config);
   ...

   const proxyEnv = useHotMemoize(module, () => createEnv('proxy'));
+  const proxySigV4Env = useHotMemoize(module, () => createEnv('proxy-sigv4'));

   const apiRouter = Router();

   apiRouter.use('/proxy', await proxy(proxyEnv));
+  apiRouter.use('/proxy-sigv4', await proxySigV4(proxySignV4Env));
   ...
 }

Configuration

Proxy routes can be configured using either a short or expanded form.

Short form

The short form is useful when the default AWS.CredentialProviderChain resolves to a set of AWS credentials that have the permissions necessary to invoke the target API directly.

This is commonplace when the IAM instance profile has been configured with a role that has been granted access on the target API and no additional AssumeRole call is required.

This is also useful during local development when the shell environment used to start the application already has AWS credentials exported into the shell's environment variables.

proxysigv4:
  '/some-local-path': https://<API ID>.execute-api.<region>.amazonaws.com

Expanded form

The expanded form is necessary when an AssumeRole call is required, or if the target API service and region cannot be automatically derived from the URL (commonplace when a custom domain name has been configured for an API Gateway endpoint).

proxysigv4:
  '/some-local-path':
    target: 'https://<API ID>.execute-api.<region>.amazonaws.com'
    roleArn: 'arn:aws:iam::<account>:role/<name>'
    roleSessionName: tempAssumeRoleSession ## optional

New Auth Services - Unauthorized Requests

When using the new backend system with the new auth services, the proxy-sigv4 backend plugin will by default allow unauthenticated requests.

To prevent this behavior, provide the following configuration:

proxysigv4:
  allowUnauthenticatedRequests: false

Doing so will not add the auth policty that allows unauthenticated requests.

Schema

Refer to config.d.ts for the full plugin type definition.

Limitations

  1. No response streaming.
  2. No configuration of the forwarded or received headers allowlist.
  3. No ability to override or manually configure target URL service and region properties
    • CNAME'd endpoints are therefore not currently supported
  4. Target URLs that lack a trailing slash (/) will always have one implicitly applied.
    • e.g.: https://example.com/foo will be treated as https://example.com/foo/
  5. Target URLs with a path prefix may be susceptible to path traversal attacks; test coverage for this is poor.

Links