npm package discovery and stats viewer.

Discover Tips

  • General search

    [free text search, go nuts!]

  • Package details

    pkg:[package-name]

  • User packages

    @[username]

Sponsor

Optimize Toolset

I’ve always been into building performant and accessible sites, but lately I’ve been taking it extremely seriously. So much so that I’ve been building a tool to help me optimize and monitor the sites that I build to make sure that I’m making an attempt to offer the best experience to those who visit them. If you’re into performant, accessible and SEO friendly sites, you might like it too! You can check it out at Optimize Toolset.

About

Hi, 👋, I’m Ryan Hefner  and I built this site for me, and you! The goal of this site was to provide an easy way for me to check the stats on my npm packages, both for prioritizing issues and updates, and to give me a little kick in the pants to keep up on stuff.

As I was building it, I realized that I was actually using the tool to build the tool, and figured I might as well put this out there and hopefully others will find it to be a fast and useful way to search and browse npm packages as I have.

If you’re interested in other things I’m working on, follow me on Twitter or check out the open source projects I’ve been publishing on GitHub.

I am also working on a Twitter bot for this site to tweet the most popular, newest, random packages from npm. Please follow that account now and it will start sending out packages soon–ish.

Open Software & Tools

This site wouldn’t be possible without the immense generosity and tireless efforts from the people who make contributions to the world and share their work via open source initiatives. Thank you 🙏

© 2024 – Pkg Stats / Ryan Hefner

@segment/analytics-consent-wrapper-onetrust

v1.1.1

Published

<img src="img/onetrust-popup.jpg" width="500" />

Downloads

5,556

Maintainers

yshkpryshkprpriyanshispriyanshisjbasiglio-segmentjbasiglio-segmentpraguptapraguptasbhodiwalsbhodiwalsahilsharma0709sahilsharma0709farhan0581farhan0581jkusa_segmentjkusa_segmentharksinghharksingharjunbhandagearjunbhandagey.yuy.yuslenin-twilioslenin-twilioskondamuriskondamurinithan-twilionithan-twiliopraveenugiripraveenugiribnakkinabnakkinahema-bahirwani-segmenthema-bahirwani-segmentsandhya16sandhya16nemery-segmentnemery-segmentighorelaighorelamansarimansaribhavanki-segmentbhavanki-segmentar7devar7devvaibhavnandavaibhavnandanikumarsegmentnikumarsegmentitsarijitrayitsarijitrayssunejassunejaazhaotwilioazhaotwilioldelossantosldelossantoscjo2cjo2achandrashekaranachandrashekaranaparna.singhalaparna.singhalynguyenynguyentimmyzsearcytimmyzsearcyigracheva-twilioigracheva-twilioyashnit-segmentyashnit-segmentnanotimmnanotimmsrivig21srivig21chenchensegmentcomchenchensegmentcomsanket.mishrasanket.mishralweimersegmentlweimersegmentrcheedhallarcheedhallajxin_twiliojxin_twilioodoren_segmentodoren_segmentaditi.raveeshaditi.raveeshdltnbrks-segmentdltnbrks-segmentsai-patanjalisai-patanjalihimanshuphhimanshuphalecjacobs-segmentalecjacobs-segmentsshaikh_segmentsshaikh_segmentjohn.lee1100john.lee1100dazu70dazu70brian.aguirrebrian.aguirrepooja.patilpooja.patilsegment_fansegment_fannlubchenconlubchencojsh-wujsh-wunithin-bennynithin-bennypoojasegmentpoojasegmentebru.odokebru.odokbannapplebannapplerodhilton_twiliorodhilton_twilioguthriesegmentguthriesegmentsrishti-nemasrishti-nemacdelaomartinezcdelaomartinezmiguelpdiaz8miguelpdiaz8sundareswar.jayakumarsundareswar.jayakumargbatragbatraspencerattickspencerattickakodankiryakodankirynanette.ranesnanette.ranesgsolis_segmentgsolis_segmentnitinpm432nitinpm432amigandhiamigandhisegmentseansegmentseanhmohanram_seghmohanram_segjrupasinghejrupasinghedevthaledevthalesmccoy-twiliosmccoy-twilioseg-leonelsanchesseg-leonelsanchesjibrangjibrangsethgrid_segmentsethgrid_segmentlight-bringer-blrlight-bringer-blraubreysineaubreysineed-twilion-npmed-twilion-npmharsh-joshi99harsh-joshi99irfan.ali.segmentirfan.ali.segmentkbhargavaram-sgkbhargavaram-sgneedcaffeineneedcaffeinenat-gridnat-gridwlumsegmentwlumsegmentmoyara2moyara2bala.singareddybala.singareddyakash.gautam07akash.gautam07preetyppreetypviveksainaneesegmentviveksainaneesegmentmsarafmsarafkjoerreskjoerresrokatyalrokatyalainatancincoainatancincoanton-vylushchakanton-vylushchaksowjanyasegmentsowjanyasegmentalayvoraalayvoratw-dgarciatw-dgarciaparag.pandaparag.pandablangtwilioblangtwilioryanrouleau-segmentryanrouleau-segmenttwjosiahtwjosiahmcullenmeyermcullenmeyerdavid.anusontarangkul.segmentdavid.anusontarangkul.segmentmckern_segmentmckern_segmentsegment-adminsegment-adminnainy.agrawalnainy.agrawaltdibaccotdibaccosudojatinsudojatinnageshgolemnageshgolembrandonheyer-segmentbrandonheyer-segmentalfrimpongalfrimpongdobrin.ganevdobrin.ganevankit.gupta.unthinkableankit.gupta.unthinkablemarinheromarinherobenattwiliobenattwiliobharath.boregowdabharath.boregowdaconniechenconniechensungju.jinsungju.jinpooyajpooyajyli119yli119ea_segmentea_segmentemilyjiaemilyjiakx-segmentkx-segmentxinghao.huangxinghao.huangharsh.vardhanharsh.vardhanjoe.ayoub.segmentjoe.ayoub.segmentgkochar123gkochar123rollcoderollcodeariel.silvestriariel.silvestricherylj-segmentcherylj-segmentimmanojimmanojaaronklishaaronklishmichelrmichelrmaneesh.dharma29maneesh.dharma29brianhumphreystwiliobrianhumphreystwiliojfehrman.segmentjfehrman.segmentjoetessyjoetessypmuninpmuninjalexy12jalexy12jbandi-twiliojbandi-twilioprayansh-twilioprayansh-twiliodominicbarnesdominicbarnesbrandon.scott-segmentbrandon.scott-segmentbgillanbgillanphillip.thomasphillip.thomasricardo.rossiricardo.rossiforgetfulfellowforgetfulfellowfauzy.yyfauzy.yymayur-pitalemayur-pitaledbaik-twilio-segmentdbaik-twilio-segmentseg-rustybaileyseg-rustybaileytanya.gupta.segmenttanya.gupta.segmentpmiller-twiliopmiller-twilionevermore2022nevermore2022aishikawakiaishikawakicsayusocsayusomcoulibalimcoulibalishupadhyayshupadhyayjahood-twiliojahood-twiliosaisagarkappaganthulasaisagarkappaganthularmukundanrmukundanarubiochavezarubiochavezshuvrajit9904shuvrajit9904s3gm3nts3gm3ntama0223ama0223tbrennanjtbrennanjdangmai-segmentdangmai-segmentshraddha-twilioshraddha-twiliosa-jsootersa-jsooterenyi.asonyeenyi.asonyeafsha-nazim-segafsha-nazim-segmschaszbergermschaszbergerlnambalnambavaradarajan-twvaradarajan-twseanhan-segmentseanhan-segmentreplateroreplaterosayan-das-insayan-das-injusteenjusteenjgabe13jgabe13meg1000meg1000funlufunluashwitha.bgashwitha.bgwhaider_twiliowhaider_twiliotcgilberttcgilbertkevinburkesegmentkevinburkesegmentfelttripfelttripprabhnoor1997prabhnoor1997akashyap91akashyap91clintz.segclintz.segkarimkeshwanikarimkeshwaniwally.tgwally.tgrhall-twiliorhall-twilioyash-twilioyash-twiliobrookstaylorjrbrookstaylorjrshayan-golafshanishayan-golafshanilerahulramlerahulrammugelstadmugelstadrrivera-segmentrrivera-segmentsethnutetwiliosethnutetwiliomanali-bhosalemanali-bhosalechtoombschtoombssethsegmentsethsegmenteric-hydeeric-hydeelmoselyeeelmoselyeemichaelghsegmichaelghsegjayakrishnannairjayakrishnannairlateefatlateefatmaryam.sharifmaryam.sharifwdbettswdbettsryanligonryanligonsindhusegmentsindhusegmentlfdelossantoslfdelossantosaramakrishnanaramakrishnanvbatanovvbatanovlluque-twiliolluque-twiliojair.avilesjair.avilespmaidpmaidsong4yousong4youpeterdemartinipeterdemartiniemmy.byrneemmy.byrnevincen7tranvincen7trandean-huynhdean-huynhcdignam-segmentcdignam-segmentabhinavsurekaabhinavsurekaarunlalam-segmentarunlalam-segmentneeharikakondipatineeharikakondipatisimpixelatedsimpixelatedchihchun-twiliochihchun-twilioacharles14acharles14jyim008jyim008fhalim-segmentfhalim-segmentcfreecfreehjoonpmhjoonpmceline-segmentceline-segmentpmcanseco-segmentpmcanseco-segmentmasiramasiraamillet89amillet89cholt002cholt002av-segmentav-segmentaghotikaraghotikarvikrant-segmentvikrant-segmentlarryatsegmentlarryatsegmentscruwys1scruwys1kyliepedersenkyliepedersenjinaparkjinaparksegmentiosegmentiorajulvaderarajulvaderalpediredlalpediredlan2parkon2parkotyson_segmenttyson_segmentbgamwellbgamwellsalolivaressalolivareserikdwerikdwchenxiangzhangchenxiangzhangmericssonmericssonprayansh-segmenttprayansh-segmenttjeremylarkinjeremylarkinbsneedbsneeddanieljackinsdanieljackinssegment-sethsegment-sethjames9446james9446priscilla.giattipriscilla.giattinlsunnlsundrew-thompsondrew-thompsonsegment-jsinghsegment-jsinghandrius-segmentandrius-segmentvalerieernstvalerieernstgilomergilomermarcelopvmarcelopveric.rognereric.rognerkdharaiyakdharaiyajon.anderson-at-segment.comjon.anderson-at-segment.comstacy.songstacy.songrexatsegmentrexatsegmentnickaguilarnickaguilarbradenbeckerbradenbeckerreneewangreneewangdan.laskydan.laskysam.tapiasam.tapiavikramkumar19vikramkumar19mpriyad25mpriyad25jeremy.parkerjeremy.parkersmidgessmidges

Readme

@segment/analytics-consent-wrapper-onetrust

Quick Start

Configure OneTrust + Segment

Requirements

Ensure that consent is enabled and that you have registered your integration-to-category mappings in Segment, which you can do through the Segment UI.

Note: "categories" are called "groups" in OneTrust.

If you don't see a "Consent Management" option like the one below, please contact support or your Solutions Engineer to have it enabled on your workspace.

Segment.io consent management UI

For snippet users

Add OneTrust snippet and integration to your page

<head>
  <!-- OneTrust Cookies Consent Notice start for example.com -->
  <script
    src="https://cdn.cookielaw.org/scripttemplates/otSDKStub.js"
    type="text/javascript"
    charset="UTF-8"
    data-domain-script="0000-0000-000-0000"
  ></script>
  <script type="text/javascript">
    function OptanonWrapper() {}
  </script>

  <!-- Add Segment's OneTrust Consent Wrapper -->
  <script src="https://cdn.jsdelivr.net/npm/@segment/analytics-consent-wrapper-onetrust@latest/dist/umd/analytics-onetrust.umd.js"></script>

  <!--
    Add / Modify Segment Analytics Snippet
    * Find and replace: analytics.load('<MY_WRITE_KEY'>) -> withOneTrust(analytics).load('<MY_WRITE_KEY'>)
  -->
  <script>
    !function(){var analytics=window.analytics...
    ....
    withOneTrust(analytics).load('<MY_WRITE_KEY'>) // replace analytics.load()
    analytics.page()
  </script>
</head>

⚠️ Reminder: you must modify analytics.load('....') from the original Segment snippet. See markup comment in example above.

For npm library users

  1. Ensure that OneTrust Snippet is loaded. See example above.

  2. Install the package from npm

# npm
npm install @segment/analytics-consent-wrapper-onetrust

# yarn
yarn add @segment/analytics-consent-wrapper-onetrust

# pnpm
pnpm add @segment/analytics-consent-wrapper-onetrust
  1. Initialize alongside analytics
import { withOneTrust } from '@segment/analytics-consent-wrapper-onetrust'
import { AnalyticsBrowser } from '@segment/analytics-next'

export const analytics = new AnalyticsBrowser()

withOneTrust(analytics).load({ writeKey: '<MY_WRITE_KEY'> })

Settings

Consent Models

  • opt-in - (strict, GDPR scenario) -- wait for explicit consent (i.e. alert box to be closed) before loading device mode destinations and initializing Segment. If consent is not given (no mapped categories are consented to), then Segment is not loaded.

  • opt-out - Load segment immediately and all destinations, based on default categories. For device mode destinations, any analytics.js-originated events (e.g analytics.track) will be filtered based on consent.

  • default/other - opt-out

This wrapper uses the OneTrust.getDomainData() API to get the consent model for a given geolocation. Default behavior can be overridden by doing:

withOneTrust(analytics, { consentModel: () => 'opt-in' | 'opt-out' })
  .load({ writeKey: '<MY_WRITE_KEY>' })

Environments

Build Artifacts

  • We build the following versions of the library

| Format | Description | Path | |--------|-------------|------| | cjs (CommonJS modules) | For npm library users | /dist/cjs/index.js | | esm (ES6 modules) | For npm library users | /dist/esm/index.js | | global (window bundle) | This is the least amount of code. When you load this bundle via script tag, it simply exposes window.withOneTrust | /dist/umd/analytics-onetrust.global.js | | umd (umd bundle) | When a UMD bundle is required | /dist/umd/analytics-onetrust.umd.js |

Browser Support

  • cjs/esm - Support modern JS syntax (ES2020). These are our npm library users, so we expect them to transpile this module themselves using something like babel/webpack if they need extra legacy browser support.

  • umd/global - Support back to IE11, but do not polyfill . See our docs on supported browsers.

In order to get full ie11 support, you are expected to bring your own polyfills. e.g. adding the following to your script tag:

<script src="https://cdnjs.cloudflare.com/ajax/libs/babel-polyfill/7.7.0/polyfill.min.js"></script>