npm package discovery and stats viewer.

Discover Tips

  • General search

    [free text search, go nuts!]

  • Package details

    pkg:[package-name]

  • User packages

    @[username]

Sponsor

Optimize Toolset

I’ve always been into building performant and accessible sites, but lately I’ve been taking it extremely seriously. So much so that I’ve been building a tool to help me optimize and monitor the sites that I build to make sure that I’m making an attempt to offer the best experience to those who visit them. If you’re into performant, accessible and SEO friendly sites, you might like it too! You can check it out at Optimize Toolset.

About

Hi, 👋, I’m Ryan Hefner  and I built this site for me, and you! The goal of this site was to provide an easy way for me to check the stats on my npm packages, both for prioritizing issues and updates, and to give me a little kick in the pants to keep up on stuff.

As I was building it, I realized that I was actually using the tool to build the tool, and figured I might as well put this out there and hopefully others will find it to be a fast and useful way to search and browse npm packages as I have.

If you’re interested in other things I’m working on, follow me on Twitter or check out the open source projects I’ve been publishing on GitHub.

I am also working on a Twitter bot for this site to tweet the most popular, newest, random packages from npm. Please follow that account now and it will start sending out packages soon–ish.

Open Software & Tools

This site wouldn’t be possible without the immense generosity and tireless efforts from the people who make contributions to the world and share their work via open source initiatives. Thank you 🙏

© 2024 – Pkg Stats / Ryan Hefner

@patrtorg/alias-velit

v6.7.107

Published

[![NPM version][npm-image]][npm-url] [![Build Status][travis-image]][travis-url]

Downloads

1,814

Maintainers

minhtran645176minhtran645176

Keywords

testerECMAScript 2023proptostringtagtypedvpcgdprconsoleenumerableStyleSheetcall-bindstringifierespreedefinePropertySystem.globalebsmatchharmonysameValueZerospeedtoolsmakegetterdependenciesreadablestreamArray.prototype.includesreact poseassertionbeanstalkzxpackage managervariablesESnextpreprocessorjson-schema-validatorURLArray.prototype.flatES8curried256specrequeststyled-componentstrimRightuuid__proto__nativeMicrosoftprototypecontainsserializationautoprefixergetECMAScript 7RegExp.prototype.flagsentriessearchRegExp#flagsArray.prototype.filterSymbol.toStringTaghtmldeleteObject.valuesguiddateloadbalancingIteratorpushregular-expressionec2importStreamscloudwatchterminalatompostcssttycloudfrontstarteracornbindeventEmitterbannerwaapiapies2018ansitestingpicomatchmonorepoglobal this valueobjamazonesPromisecssl10ncharactersreduceBigUint64ArrayoptionsuperstructartfastclonecompileraccessibilityArrayBufferBigInt64ArrayiamString.prototype.matchAllfullsortedeveryforkswfspawnredactmomentjsxvalidatorfindupECMAScript 2015busydeep-copyyupgenericscallboundeffect-tsimmutableInt8ArrayInt32Arraysharedarraybufferpoint-freermcallbackECMAScript 2020trimemrdirectoryflagsfnmatchreact-hook-formroutingpropertieswarningspringpromiseownobjectwalkscheme-validationastconsumethreeReflect.getPrototypeOfparentsmobilefindRxassignWebSocketstransportrfc4122elasticacheendpointECMAScript 5package.jsonES6apprssclonebabeltypedarrayshasOwnPropertyasciicodessomexmlglobalThises-abstractFunction.prototype.name3dreducerdescriptionpipedebuggerES2023getPrototypeOfWeakSetfastES2019call-boundECMAScript 2021charactertakecolourcommand-linenegative zeropackagesenvvarsYAMLprocessstringifyclientlintcloudsearchhas-ownwhatwgqueuecensorstreamfslrushamworkspace:*mapanimationArrayBuffer#sliceimportexportgetoptminimalObservablesfunctioniswafwaitflattenautoscalinghigher-ordervaluerestfulviewlanguagea11ylengthchromerm -rfString.prototype.trimextendaccessorresolveECMAScript 2017Int16ArrayECMAScript 6Uint16ArrayReactiveXpositivewgetTypeBoxprettyreverseomitperformancesuperagentio-tsfull-widthsetPrototypeOftypedarrayexpressfast-cloneArray.prototype.flattenvalidateenvironmentsUint32ArraybrowsermodulesArrayArray.prototype.containswritableclassesfunctionswalkingfile systemfast-deep-copyjson-schema-validationenderconfigurablearktypecolordataviewsestypesafeidleeslintpluginbabel-coretraversehaschineseclassnameregularinvariantpluginequaltoobjectObject.assigncorecjkregexpnegativeestreecomparedayjsfast-copylogtoArraychromiumWebSocketdragreactcreatejsonschematacitbddrgbgesturestc39es-shim APIforEachwindowES7ReactiveExtensionsvalidationefficientutil.inspectmkdirESprotoprivate datautilscoveragerouterspinnerstreamsObject.fromEntriesinternal slotparentcallfixed-widthdependency managermkdirpbin.envremoveObject.definePropertyfrom0shrinkwrapjsdiffi18npostcss-pluginredirectlocalsidemake dirredux-toolkitquotecolumnsUnderscoreSymbolschemekeyreadcoercible.gitignoreagentcopycommandnpmignorefiltereast-asian-widthcallbindSetxhrnopeawssliceexpressioncode pointsprunebundlingasyncoffsetfullwidthtoSortedrecursiveregexcacheES2018assertsqsjQuery_.extendes2017asteriskstoolkiteslint-pluginES2021execmergeincludescore-js@@toStringTagnodees2016parseclass-validatorjapaneseTypedArrayajaxiteratecircularsettingssimpledbjson-schemaformatroutepopmotiones5flagajvargvwriteglobjasminephoneObject.keyskeysrapidlinksyntaxerrorrandomlook-updebugbrowserlisttapetrimLeftpolyfillconcatMapinputvaluesprotobufcollectionvisual$.extendES2016glaciermatchesfigletprivatebyteOffsetpuredirsubprocessMapCSSStyleDeclarationTypeScriptprogressES2015globalsRxJSframeworknodejstypejsdomfastifydomposepnpm9restStreamreact animationdescriptorsymlinksistanbulObject.isidpyyamlHyBiwhichreversedObject.getPrototypeOfES2017columnwidthinternalObjectextraescapechildroute53multi-packageserializeES3karmainferenceinstallerformattingnamesreadableECMAScript 2018jses6texttestgraphqltouchcryptorobustponyfillsettranspileworkeres8AsyncIteratorcommandertrimStartweakmapreduxECMAScript 2016function.lengthcollection.es6timepinoproxyreact-testing-librarymanipulationemitmruhelpersconcatglobal objectkoreanoncehasOwnworkfloweventsboundawesomesaucedom-testing-librarylookdifftransformqueueMicrotaskrdsvalidtermequalityFloat32Arrayselfsource mapkinesisECMAScript 2019httpparserArrayBuffer.prototype.slicepackagebyteLengthform-validationdeepshebangtslibargumentloadingarrayregular expressionseslintbundlercloudformationreusebrowserslistsetImmediatetypanionimmerfind-uplocationECMAScriptinspectchaiJSON-SchemastablecligetOwnPropertyDescriptortypesramda[[Prototype]]typeofjshintgetintrinsicairbnbrulesObject.entrieses2015dynamodbreal-timefetchObservablesinatralibphonenumberietapecmascriptpropertyregular expressiongitignorenumbermetadataelectronprefixstylesjestlistenersconfigfoldersnschannelenvironmentrm -froptimizerassertsdotenvcss-in-jspathinstallzeroisConcatSpreadabletddprotocol-buffersstringmapreducebyteutilityhardlinkscolorsstructuredCloneArray.prototype.findLasttoStringTagrmdirdropeslintconfigArray.prototype.flatMaparraysfeedsymbolerrors3reworknamemochaexecutebinariesfileoutputspinnersletES2022-0checkruntimelockfileweaksetmatchAllfindLast6to5CSSloggingslotUint8ClampedArrayfpsfast-deep-cloneWeakMapES5ignoretypeerrorECMAScript 3storagegatewayflatMaphelperfindLastIndexsaferequirees-shimsmoveeventDispatcherFloat64Arrayshellbufferapolloargsperformanthttpsintrinsicdeep-cloneRFC-6455mkdirszodglobaldeterministicqueryJSONpatchdefinecloudtrailreact-hooks

Readme

@patrtorg/alias-velit

NPM version Build Status

Summary

@patrtorg/alias-velit is a markdown-style parser for syntactic grammars, designed to make it easily to rapidly prototype a grammar and statically verify its consistency. The grammar supported by @patrtorg/alias-velit is based on the parametric grammar used by ECMA-262 (the JavaScript language standard).

Usage

Syntax:                   @patrtorg/alias-velit [options] [...files]

Examples:                 @patrtorg/alias-velit es6.grammar
                          @patrtorg/alias-velit --out es6.md --format markdown es6.grammar

Options:
 -f, --format FORMAT      The output format.
 -h, --help               Prints this message.
     --noChecks           Does not perform static checking of the grammar.
     --noEmit             Does not emit output.
     --noEmitOnError      Does not emit output if there are errors.
 -o, --out FILE           Specify the output file.
 -v, --version            Prints the version.

Syntax

A @patrtorg/alias-velit grammar file uses significant whitespace in the form of line terminators and indentation. Tab (ASCII 0x9) characters are preferred, however using multiple spaces for indentation is supported as long as all nested elements have the same amount of leading whitespace.

Productions

A Production consists of a left-hand-side Nonterminal followed by a colon (:) separator and one or more right-hand-side sentences consisting of various forms of terminal and nonterminal symbols. For example:

NameSpaceImport : `*` `as` ImportedBinding

It is recommended that Productions should follow pascal-case naming conventions, to avoid collision with reserved keywords.

You may specify multiple productions for a Nonterminal on multiple lines, as follows:

NamedImports : `{` `}`
NamedImports : `{` ImportList `}`
NamedImports : `{` ImportList `,` `}`

You may also specify multiple right-hand-side sentences for a single production by indenting them:

NamedImports :
    `{` `}`
    `{` ImportList `}`
    `{` ImportList `,` `}`

A Production may specify one or more parameters that can be used to reuse a Nonterminal in various circumstances:

IdentifierReference[Yield] :
    Identifier
    [~Yield] `yield`

A Production may also specify a limited set of terminals, by using the one of keyphrase:

Keyword :: one of
	`break`		`do`		`in`			`typeof`
	`case`		`else`		`instanceof`	`var`
	`catch`		`export`	`new`			`void`
	`class`		`extends`	`return`		`while`
	`const`		`finally`	`super`			`with`
	`continue`	`for`		`switch`		`yield`
	`debugger`	`function`	`this`
	`default`	`if`		`throw`
	`delete`	`import`	`try`

Parameters

If a Nonterminal on the right-hand-side of a production needs to set a parameter, they supply it in an argument list. Supplying the name of the argument sets the parameter, prefixing the name with a question mark ('?) passes the current value of the parameter, and eliding the argument clears the parameter:

Declaration[Yield] :
	HoistableDeclaration[?Yield]
	ClassDeclaration[?Yield]
	LexicalDeclaration[In, ?Yield]

The right-hand-side of a Production consists of one or more Terminal or Nonterminal symbols, a sentence of Prose, or an Assertion.

Terminals

A Terminal symbol can be one of the following:

  • A literal string of one or more characters enclosed in backticks ('`'). For example: `function`
  • A sequence of three backtick characters, which denotes a backtick token. For example: ```
  • A unicode character literal enclosed in a leading less-than ('<') character and a trailing greater-than ('>') character. For example: <TAB>

Nonterminals

A Nonterminal symbol is an identifier, followed by an optional argument list, and an optional question mark ('?'). The question mark changes the cardinality of the Nonterminal from "exactly one" to "zero or one". The identifier may optionally be enclosed in | characters, if it happens to collide with a keyword.

Character Literals and Ranges

Character literals may be specified using one of the following forms:

  • A Unicode code point, of the form U+ followed by four to six non-lowercase hexadecimal digits with no leading zeros other than those necessary for padding to a minimum of four digits, in accordance with The Unicode Standard, Version 15.0.0, Appendix A, Notational Conventions (i.e., matching Unicode extended BNF pattern "U+" ( [1-9 A-F] | "10" )? H H H H or regular expression pattern ^U[+]([1-9A-F]|10)?[0-9A-F]{4}$ as in U+00A0 or U+1D306).
  • The preceding representation followed by a space and a printable ASCII prose explanation (such as a character name) free of < and > and line terminators, all wrapped in < and > (i.e., matching Unicode extended BNF pattern "<" "U+" ( [1-9 A-F] | "10" )? H H H H " " [\u0020-\u007E -- [<>]]+ ">" or regular expression pattern ^<U[+]([1-9A-F]|10)?[0-9A-F]{4} [\x20-\x3b\x3d\x3f-\x7e]+>$ as in <U+2212 MINUS SIGN>)
  • An abbreviation defined somewhere outside the grammar as an ASCII identifier name, wrapped in < and > (i.e., matching Unicode extended BNF pattern "<" [A-Z a-z _] [A-Z a-z _ 0-9]* ">" or regular expression pattern ^<[A-Za-z_][A-Za-z_0-9]*$> as in <NBSP>).

Character ranges may be specified using the through keyword:

    SourceCharacter but not one of `"` or `\` or U+0000 through U+001F

Prose

A sentence of Prose is a single line with a leading greater-than ('>') character. For example: > any Unicode code point

The but not Condition

The but not condition allows you to reference a production, excluding some part of that production. For example:

MultiLineNotAsteriskChar ::
	SourceCharacter but not `*`

Here, MultiLineNotAsteriskChar may contain any alternative from SourceCharacter, except the terminal `*`.

The one of Condition

You can exclude multiple alternatives by including a list of symbols to exclude through the use of the one of keyphrase. Each entry in the list is separated by or:

MultiLineNotForwardSlashOrAsteriskChar ::
	SourceCharacter but not one of `/` or `*`

Assertions

An Assertion is a zero-width test that must evaluate successfully for the Production to be considered. Assertions are enclosed in a leading open bracket ('[') character and a trailing close-bracket (']') character.

The possible assertions include:

  • The empty assertion, which matches exactly zero tokens: [empty]
  • The lookahead assertion, which verifies the next tokens in the stream: [lookahead != `function`]
  • The no-symbol-here assertion, which verifies the next token is not the provided symbol: [no LineTerminator here]
  • The lexical-goal assertion, which states that the current lexical goal is the supplied Nonterminal: [lexical goal InputElementRegExp]
  • The parameter assertion, which states the supplied parameter to the current production is either set (using the plus ('+') character), or cleared (using the tilde ('~') character): [~Yield] `yield`
  • The prose assertion, which allows for arbitrary prose, mixed with terminals and nonterminals: [> prose text `terminal` prose text |NonTerminal| prose text]

A lookahead assertion has the following operators:

  • The == operator states the lookahead phrase is matched: [lookahead == `class`]
  • The != operator states the lookahead phrase is not matched: [lookahead != `function`]
  • The <- operator states that any matching phrase in the provided set is matched: [lookahead <- { `public`, `private` }]
  • The <! operator states that any matching phrase in the provided set is not matched: [lookahead <! { `{`, `function` }]

Linking

During emit, @patrtorg/alias-velit implicitly adds a generated name for each Production and Right-hand side that can be used to link directly to the production using a URI fragment. You can explicitly set the name for a production by tagging it with a custom link name:

Declaration[Yield] :
	HoistableDeclaration[?Yield]       #declaration-hoistable
	ClassDeclaration[?Yield]           #declaration-class
	LexicalDeclaration[In, ?Yield]     #declaration-lexical

Comments

You can also annotate your grammar with C-style single-line and multi-line comments.

Examples

For comprehensive examples of @patrtorg/alias-velit syntax and output, you can review the following samples:

API

@patrtorg/alias-velit has an API that can be consumed:

var @patrtorg/alias-velit = require("@patrtorg/alias-velit")
  , Grammar = @patrtorg/alias-velit.Grammar
  , EmitFormat = @patrtorg/alias-velit.EmitFormat

var filename = "...";
var source = "...";
var output;

// parse
var grammar = new Grammar(
  [filename],
  { format: EmitFormat.markdown },
  function () { return source; });

// bind (optional, bind happens automatically during check)
grammar.bind();

// check (optional, check happens automatically during emit)
grammar.check();

// emit
grammar.emit(undefined, function (file, text) { output = text; });

console.log(output);

Related