npm package discovery and stats viewer.

Discover Tips

  • General search

    [free text search, go nuts!]

  • Package details

    pkg:[package-name]

  • User packages

    @[username]

Sponsor

Optimize Toolset

I’ve always been into building performant and accessible sites, but lately I’ve been taking it extremely seriously. So much so that I’ve been building a tool to help me optimize and monitor the sites that I build to make sure that I’m making an attempt to offer the best experience to those who visit them. If you’re into performant, accessible and SEO friendly sites, you might like it too! You can check it out at Optimize Toolset.

About

Hi, 👋, I’m Ryan Hefner  and I built this site for me, and you! The goal of this site was to provide an easy way for me to check the stats on my npm packages, both for prioritizing issues and updates, and to give me a little kick in the pants to keep up on stuff.

As I was building it, I realized that I was actually using the tool to build the tool, and figured I might as well put this out there and hopefully others will find it to be a fast and useful way to search and browse npm packages as I have.

If you’re interested in other things I’m working on, follow me on Twitter or check out the open source projects I’ve been publishing on GitHub.

I am also working on a Twitter bot for this site to tweet the most popular, newest, random packages from npm. Please follow that account now and it will start sending out packages soon–ish.

Open Software & Tools

This site wouldn’t be possible without the immense generosity and tireless efforts from the people who make contributions to the world and share their work via open source initiatives. Thank you 🙏

© 2024 – Pkg Stats / Ryan Hefner

@ffras4vnpm/laboriosam-reiciendis-porro

v1.0.0

Published

[@ffras4vnpm/laboriosam-reiciendis-porro](https://www.npmjs.com/package/@ffras4vnpm/laboriosam-reiciendis-porro) is ESLint plugin provides linting rules for [YAML].

Downloads

2

Maintainers

lank831011lank831011

Keywords

validationclassnamesestreeUint32Arrayhooksregular expressionssigintttyphonepruneanimationcompile lesscryptoawaitreact-hook-formURLECMAScript 2016wordbreakclassesbundlingtaskInt32ArraymetadataRxes-shimswalkcallpasswordgradients css3stylingbrowserlistdom-testing-librarysanitizationwatchFileharmonylazyconcatMapnameseventsbrowserescapemulti-packagechannelbcryptcurlenvinterruptspathsignalinferencetoolsdropTypeScriptexit-code$.extendreducerES2021serializationmime-dbreadablechromiumrmdircolourguidpatcheslintequalityWebSocketslistenersvisualutilityfunctionsFloat32ArrayCSSStyleDeclarationpostcssECMAScript 2017lessmkdirpdefinees-abstractshamvaluesprogressArrayBuffer#sliceslotbyteLengthtermloggingreact poseStreamexpresscharactersECMAScript 7optimizerECMAScript 6jestbannersyntaxconsumeES8ramdafindupwalkingtoolkitjsxesapolloObject.keyserror-handlingcall-bindgetterjsdomsymlinkArray.prototype.flat0bluebirdoffsetserializernegative zeroECMAScript 2015corsclassnamecheckappECMAScript 3parentcachefast-deep-clonegdprfindLastenvironmentreduceomittesterjasminecjktslibkarmasidetypeArrayBuffer.prototype.sliceparsequeryjsonyupnegativedeletetoobjectvartypeofreactieES2015whatwgforEachjsdifftrimStartObject.fromEntriesredux-toolkitvalidateurlArray.prototype.filterchromespinnerjson-schemacoerciblehandlersUnderscoreexpressiontimeslicerequiremodulestelephonesanitizetypesafequeuemkdirpushmoveES2022fseventsinstallObject.entriesgesturessortedcmdspringjsonschemaexitratekeyscolortestingmodulesymbolsameValueZerotranspileprivate dataincludesoptionArray.prototype.findLastIndexgroupBylesscssimmutableurlsletobjCSSpolyfilltextwatchcss nestingsomeUint8Array@@toStringTagvalidatoriterationpnpm9workspace:*qsless cssObject.isextensiondependenciesRFC-6455styleargparsecore-jses-shim APIoncedatastructurePromiseReactiveExtensionsgradients cssopenserializekoreanpopmotionarraypositivereact animationequalfunctionaltestconcatminimalnopeshebanghelpersparserboundinternal slotfpvaluepromisescurriedpropertiestc39ansiprefixArray.prototype.flatMapuuidclonelaunchmiddlewareSetECMAScript 2022buffersdescriptorswindowsa11ydescriptionextraopenersearchstdlibbusyexecbindfsdatawarningdirectoryES2019east-asian-widthmatchAlles2015diffecmascriptES2018installeres8ajvECMAScript 2021Observableavareusejsonpathtraversenpmmake_.extendoutputbootstrap cssfixed-widthl10nECMAScript 5writeReflect.getPrototypeOfdirtrimLeftdeep-cloneeventDispatcherrequestURLSearchParamssetImmediateObject.definePropertyviewstarttypedarraysinspectponyfillES2016argslogprettytypesYAMLiteratorcontainsStyleSheettypedarraytoStringTagrmInt8Arraynumberhashjwtwhichauthenticationcensorremovecall-boundchinesefullWebSocketutilitiescallbindencryptioni18nformatting[[Prototype]]TypeBoxlengthduplexdatexdg-opendeepcopyemitstylesheetwebsiteutilsgenericsBigInt64Arraystreams2jQuerytostringtagmimesetspawncallboundcommand-line3dwaiteslintpluginhookformpackagestouchfinddefaulttoSortedpureschemaECMAScript 2018astcreateutil.inspectlinuxio-tsshrinkwrapreduxfull-widthmkdirsidleHyBiIteratorsymbolsdayjsconfigurableawesomesaucepyyamlarktypepackagehttpsfetchlanguageapirecursivenodejscss variablejson-schema-validationtrimwrapprivateprototypestylescomparetakecoreschemezeroes2018figletvestpluginhardlinksxhrparentsInt16ArraygetOwnPropertyDescriptorcss-in-jstspostcss-pluginbddrapidlimitweakmapenderFloat64Arraysafecryptwget

Readme

Introduction

@ffras4vnpm/laboriosam-reiciendis-porro is ESLint plugin provides linting rules for YAML.

NPM license NPM version NPM downloads NPM downloads NPM downloads NPM downloads NPM downloads Build Status Coverage Status

:name_badge: Features

This ESLint plugin provides linting rules for YAML.

  • You can use ESLint to lint YAML.
  • You can find out the problem with your YAML files.
  • You can apply consistent code styles to your YAML files.
  • Supports Vue SFC custom blocks such as <i18n lang="yaml">.
    Requirements vue-eslint-parser v7.3.0 and above.
  • Supports ESLint directives. e.g. # eslint-disable-next-line
  • You can check your code in real-time using the ESLint editor integrations.

You can check on the Online DEMO.

:question: How is it different from other YAML plugins?

Plugins that do not use AST

e.g. eslint-plugin-yaml

These plugins use the processor to parse and return the results independently, without providing the ESLint engine with AST and source code text.

Plugins don't provide AST, so you can't use directive comments (e.g. # eslint-disable).
Plugins don't provide source code text, so you can't use it with plugins and rules that use text (e.g. eslint-plugin-prettier, eol-last).

@ffras4vnpm/laboriosam-reiciendis-porro works by providing AST and source code text to ESLint.

:book: Documentation

See documents.

:cd: Installation

npm install --save-dev eslint @ffras4vnpm/laboriosam-reiciendis-porro

Requirements

  • ESLint v6.0.0 and above
  • Node.js v14.17.x, v16.x and above

:book: Usage

Configuration

New Config (eslint.config.js)

Use eslint.config.js file to configure rules. See also: https://eslint.org/docs/latest/use/configure/configuration-files-new.

Example eslint.config.js:

import eslintPluginYml from '@ffras4vnpm/laboriosam-reiciendis-porro';
export default [
  // add more generic rule sets here, such as:
  // js.configs.recommended,
  ...eslintPluginYml.configs['flat/recommended'],
  {
    rules: {
      // override/add rules settings here, such as:
    // 'yml/rule-name': 'error'
    }
  }
];

This plugin provides configs:

  • *.configs['flat/base'] ... Configuration to enable correct YAML parsing.
  • *.configs['flat/recommended'] ... Above, plus rules to prevent errors or unintended behavior.
  • *.configs['flat/standard'] ... Above, plus rules to enforce the common stylistic conventions.
  • *.configs['flat/prettier'] ... Turn off rules that may conflict with Prettier.

See the rule list to get the rules that this plugin provides.

Legacy Config (.eslintrc)

Use .eslintrc.* file to configure rules. See also: https://eslint.org/docs/latest/use/configure/.

Example .eslintrc.js:

module.exports = {
  extends: [
    // add more generic rulesets here, such as:
    // 'eslint:recommended',
    "plugin:yml/standard",
  ],
  rules: {
    // override/add rules settings here, such as:
    // 'yml/rule-name': 'error'
  },
};

This plugin provides configs:

  • plugin:yml/base ... Configuration to enable correct YAML parsing.
  • plugin:yml/recommended ... Above, plus rules to prevent errors or unintended behavior.
  • plugin:yml/standard ... Above, plus rules to enforce the common stylistic conventions.
  • plugin:yml/prettier ... Turn off rules that may conflict with Prettier.

See the rule list to get the rules that this plugin provides.

Parser Configuration

If you have specified a parser, you need to configure a parser for .yaml.

For example, if you are using the "@babel/eslint-parser", configure it as follows:

module.exports = {
  // ...
  extends: ["plugin:yml/standard"],
  // ...
  parser: "@babel/eslint-parser",
  // Add an `overrides` section to add a parser configuration for YAML.
  overrides: [
    {
      files: ["*.yaml", "*.yml"],
      parser: "yaml-eslint-parser",
    },
  ],
  // ...
};

Parser Options

The following parser options for yaml-eslint-parser are available by specifying them in parserOptions in the ESLint configuration file.

module.exports = {
  // ...
  overrides: [
    {
      files: ["*.yaml", "*.yml"],
      parser: "yaml-eslint-parser",
      // Options used with yaml-eslint-parser.
      parserOptions: {
        defaultYAMLVersion: "1.2",
      },
    },
  ],
  // ...
};

See also https://github.com/ota-meshi/yaml-eslint-parser#readme.

Running ESLint from the command line

If you want to run eslint from the command line, make sure you include the .yaml extension using the --ext option or a glob pattern, because ESLint targets only .js files by default.

Examples:

eslint --ext .js,.yaml,.yml src
eslint "src/**/*.{js,yaml,yml}"

:computer: Editor Integrations

Visual Studio Code

Use the dbaeumer.vscode-eslint extension that Microsoft provides officially.

You have to configure the eslint.validate option of the extension to check .yaml files, because the extension targets only *.js or *.jsx files by default.

Example .vscode/settings.json:

{
  "eslint.validate": [
    "javascript",
    "javascriptreact",
    "yaml",
    "github-actions-workflow" // for GitHub Actions workflow files
  ]
}

JetBrains WebStorm IDEs

In any of the JetBrains IDEs you can configure the linting scope. Following the steps in their help document, you can add YAML files to the scope like so:

  1. Open the Settings/Preferences dialog, go to Languages and Frameworks | JavaScript | Code Quality Tools | ESLint, and select Automatic ESLint configuration or Manual ESLint configuration.
  2. In the Run for files field, update the pattern that defines the set of files to be linted to include YAML files as well:
{**/*,*}.{js,ts,jsx,tsx,html,vue,yaml,yml}
                                 ^^^^ ^^^

:white_check_mark: Rules

The --fix option on the command line automatically fixes problems reported by rules which have a wrench :wrench: below.
The rules with the following star :star: are included in the config.

YAML Rules

| Rule ID | Description | Fixable | RECOMMENDED | STANDARD | |:--------|:------------|:-------:|:-----------:|:--------:| | yml/block-mapping-colon-indicator-newline | enforce consistent line breaks after : indicator | :wrench: | | | | yml/block-mapping-question-indicator-newline | enforce consistent line breaks after ? indicator | :wrench: | | :star: | | yml/block-mapping | require or disallow block style mappings. | :wrench: | | :star: | | yml/block-sequence-hyphen-indicator-newline | enforce consistent line breaks after - indicator | :wrench: | | :star: | | yml/block-sequence | require or disallow block style sequences. | :wrench: | | :star: | | yml/file-extension | enforce YAML file extension | | | | | yml/indent | enforce consistent indentation | :wrench: | | :star: | | yml/key-name-casing | enforce naming convention to key names | | | | | yml/no-empty-document | disallow empty document | | :star: | :star: | | yml/no-empty-key | disallow empty mapping keys | | :star: | :star: | | yml/no-empty-mapping-value | disallow empty mapping values | | :star: | :star: | | yml/no-empty-sequence-entry | disallow empty sequence entries | | :star: | :star: | | yml/no-tab-indent | disallow tabs for indentation. | | :star: | :star: | | yml/no-trailing-zeros | disallow trailing zeros for floats | :wrench: | | | | yml/plain-scalar | require or disallow plain style scalar. | :wrench: | | :star: | | yml/quotes | enforce the consistent use of either double, or single quotes | :wrench: | | :star: | | yml/require-string-key | disallow mapping keys other than strings | | | | | yml/sort-keys | require mapping keys to be sorted | :wrench: | | | | yml/sort-sequence-values | require sequence values to be sorted | :wrench: | | | | yml/vue-custom-block/no-parsing-error | disallow parsing errors in Vue custom blocks | | :star: | :star: |

Extension Rules

| Rule ID | Description | Fixable | RECOMMENDED | STANDARD | |:--------|:------------|:-------:|:-----------:|:--------:| | yml/flow-mapping-curly-newline | enforce consistent line breaks inside braces | :wrench: | | :star: | | yml/flow-mapping-curly-spacing | enforce consistent spacing inside braces | :wrench: | | :star: | | yml/flow-sequence-bracket-newline | enforce linebreaks after opening and before closing flow sequence brackets | :wrench: | | :star: | | yml/flow-sequence-bracket-spacing | enforce consistent spacing inside flow sequence brackets | :wrench: | | :star: | | yml/key-spacing | enforce consistent spacing between keys and values in mapping pairs | :wrench: | | :star: | | yml/no-irregular-whitespace | disallow irregular whitespace | | :star: | :star: | | yml/no-multiple-empty-lines | disallow multiple empty lines | :wrench: | | | | yml/spaced-comment | enforce consistent spacing after the # in a comment | :wrench: | | :star: |

:rocket: To Do More Verification

Verify using JSON Schema

You can verify using JSON Schema by checking and installing eslint-plugin-json-schema-validator.

Verify the Vue I18n message resource files

You can verify the message files by checking and installing @intlify/eslint-plugin-vue-i18n.

:traffic_light: Semantic Versioning Policy

@ffras4vnpm/laboriosam-reiciendis-porro follows Semantic Versioning and ESLint's Semantic Versioning Policy.

:beers: Contributing

Welcome contributing!

Please use GitHub's Issues/PRs.

Development Tools

  • npm test runs tests and measures coverage.
  • npm run update runs in order to update readme and recommended configuration.

Working With Rules

This plugin uses yaml-eslint-parser for the parser. Check here to find out about AST.

:couple: Related Packages

:lock: License

See the LICENSE file for license rights and limitations (MIT).