npm package discovery and stats viewer.

Discover Tips

  • General search

    [free text search, go nuts!]

  • Package details

    pkg:[package-name]

  • User packages

    @[username]

Sponsor

Optimize Toolset

I’ve always been into building performant and accessible sites, but lately I’ve been taking it extremely seriously. So much so that I’ve been building a tool to help me optimize and monitor the sites that I build to make sure that I’m making an attempt to offer the best experience to those who visit them. If you’re into performant, accessible and SEO friendly sites, you might like it too! You can check it out at Optimize Toolset.

About

Hi, 👋, I’m Ryan Hefner  and I built this site for me, and you! The goal of this site was to provide an easy way for me to check the stats on my npm packages, both for prioritizing issues and updates, and to give me a little kick in the pants to keep up on stuff.

As I was building it, I realized that I was actually using the tool to build the tool, and figured I might as well put this out there and hopefully others will find it to be a fast and useful way to search and browse npm packages as I have.

If you’re interested in other things I’m working on, follow me on Twitter or check out the open source projects I’ve been publishing on GitHub.

I am also working on a Twitter bot for this site to tweet the most popular, newest, random packages from npm. Please follow that account now and it will start sending out packages soon–ish.

Open Software & Tools

This site wouldn’t be possible without the immense generosity and tireless efforts from the people who make contributions to the world and share their work via open source initiatives. Thank you 🙏

© 2024 – Pkg Stats / Ryan Hefner

@diotoborg/officia-labore

v2.4.103

Published

![@diotoborg/officia-labore logo](https://raw.githubusercontent.com/@diotoborg/officia-labore/@diotoborg/officia-labore/master/logo/logo.png)

Downloads

2,234

Maintainers

quochoanglm58quochoanglm58

Keywords

ES2023s3pureloggingeventsbabelqueueMicrotaskreplaykinesisjson-schema-validatorvaluesObject.isajvoperating-systempicomatcharktypeamazonbytepromiseArrayHyBi__proto__poseemites2017Array.prototype.findLastIndexSystem.globalenvironmentArray.prototype.flattenloadbalancingpipedotenvglobal this valueArray.prototype.flatMapforEachAsyncIteratorpatchMicrosoftcensorpackage managerdeep-clonecloudformationregular expressionservicecss nestingcall-bindglobal objectauthenticationES7fixed-widthdeep-copyhascharacterSymbolinstallerreduxreact-testing-librarytsrapiddeepcopyhashauthbrowservesttypeoffunctiones2015colorenderes-shim APIgradients csscollectionschemamockingincludesTypeBoxES8make dirstyled-componentssqsReflect.getPrototypeOfarrayECMAScript 6toolkitsymlinksbootstrap lesspoint-freeserverbufferTypedArrayworkspace:*ansifastcallbindstatusinterruptsmruoptionwritablecolumnstoSortedtoStringTagoffsetutilsautoprefixerPushArray.prototype.filterobjecttoobjectcloudtrailcertificatesglobalscopylinkruntimePromiseimportchildECMAScript 2015macostextasyncclassnamessetmobiletestquerystringpnpm9react-hooksreact-hook-formnamesES2016omit_.extendconcatrangeerrorexit-codejapaneseiamTypeScriptSetswftypedarraylesscssasciisignaltyped arrayframergenericsawesomesaucefastclonesettercss lessmulti-packageECMAScript 2023robust.gitignorefileUint32Arraypinoprettyredux-toolkitwritees-shimsCSSStyleDeclarationgetOwnPropertyDescriptorownvpcArray.prototype.includesdeepstatejsxdataViewtypedarraysless css6to5css-in-jsjsonschemashellECMAScriptwidthcreateaccessordirpluginttyfilterwhatwgObjectfindLastmovees6drageslintplugincurriedcolorsparsereffect-tspushzeronested csssigintstructuredClonelivesigtermhelpersmapreduce[[Prototype]]lastreadableclicolourbundlinges2016typescriptObject.keysES2021requestYAMLbuffersopensslxtermback-enddescriptortypeapiutilityenumerablehas-ownrulescallbackfunctionaldataviewtypeses5subprocessArrayBuffer.prototype.slicecomparerandomconcatMapObservablebabel-coreeslintdomtrimtslibschemeformattingcurltrimRightcirculari18nbootstrap csspopmotionexpressletinspectstarterutil.inspectUint8ClampedArrayarrayssymboljsonponyfilleast-asian-widthintrinsicassertWeakSetmkdirsnegative zeroFloat32ArraybrowserlistbinariesRxcore-jsformsuperagentJSONcompile lesselectrongetargsReactiveExtensionsassign0snsenvironmentsflagisprogressreact poseloggerBigInt64ArrayStreamObject.entriesdeepclonesetImmediatevalidatorIteratorWebSocketscoerciblefantasy-landjsdiffjshintRFC-6455extrasiderdsspinneroptimizerES5ECMAScript 2022whichESform-validationES2019onceflatMapdeterministicwafjavascriptgetterwindowiterationformatregexmockeslintconfigsymbolskeysflattenString.prototype.matchAllsymlinktermInt16ArrayObject.fromEntriessharedarraybufferhardlinkstestercallexecprotocol-bufferstrimStartfile systemtranspilerfetchpostcss-plugincompilerObject.valuesfindLastIndexasttoolsgitignoredropfast-deep-copysespropertiesWebSocketreact animationArray.prototype.flatredirectvarshasOwnindicatorpyyamlvalidlengthspinnerscall-boundlazyebsautoscalingacornreducersortmkdirpprocessqsbindmapES2018route53Uint8Arrayassertsserializeespreeclientglacierlocationeveryshrinkwrapprivate datareactremovesameValueZerographqlasterisksfastifyresolveramdaajaxjwtmomentdescriptorsWeakMapendpointl10nfromprefixoptimistgesturesbyteLengthless.jsserializerECMAScript 5syntaxlistenersfast-deep-cloneconfigurablekeyexitcolumninvariantglobalelbfunction.lengthconsumegetoptstringdefinePropertyhookstoArrayviewserializationspawnregularmodulepredictableECMAScript 2019windowserror-handlingtelephonerecursive256eslint-pluginutiljoimanagerparsefast-clonegroupBystringifiersimpledbspecjson-schema-validationmonorepoInt8Arraystringifylesssyntaxerrorhigher-orderless mixinsextendutilitiesuninstallMapuser-streamscloudfrontspeedunicodeidleartes7tddcryptrgbsignedECMAScript 2021transpiletostringtagperformantkoreantc39Array.prototype.contains3dlinuxpreserve-symlinksuploadstyleses-abstractglobalThisecmascriptmkdirprotosequencepostcssphonemodulesinferencechannelforkcontainsentriesprivatesettingsenvJSON-SchemaagentredactsignalsexpressionlanguageURLSearchParamsArray.prototype.findLastnumberhasOwnPropertyfpfunctionscryptoreact-componentStreamsec2ECMAScript 2018ES2022lockfilefnmatchescapeterminalpruneinstallefficienthttpCSSperformanceroutingdatebrowserslistminimalFunction.prototype.namesliceconsolematchdefinezodsharedpackage.jsonworkerSymbol.toStringTagmakedependenciesslotprotobufjsstylesheetlocallogidentifiersString.prototype.trimvarReactiveXnopehandlerstream-0immerfluxchromiumbyteOffsetyupawsdayjsinternal slotfigletcommandershebangES6fastcopy$.extendchinesetestingpathinregular-expressionelmiteratevalidationArrayBuffer#slicees2018zxiteratorObject.assigndynamodbtrimEndbinarypasswordes8es@@toStringTagurlreal-timequerystylecheckencryptionapolloexecutegetPrototypeOfprophotio-tschromepersistentUint16ArraymixinsbinarraybufferargvbundlermetadatagroupprototypeRegExp#flagseventDispatchervariables in cssoutputargumentdeleteES2017waitreusewalkhttpsspringstreamssuperstructrequireObject.definePropertycss variablelibphonenumbermatchesES2015cjkhelpernegativewgetflagsES2020xhrconstbddsortedsafeclassnamepackagesstyleguidedom-testing-libraryBigUint64ArrayerrorObject.getPrototypeOfinternalfpsvalidatehandlerseventEmittergdprRegExp.prototype.flagsweaksetpositivegetintrinsicfullwidthshimweakmapcallboundECMAScript 2020harmonycodesthreewaapinativeflattypesafescheme-validationaccessibilitycomputed-typestransportbusyimportexportless compilervariables.envcssconfigbeanstalkairbnbimmutabletypeerroranimationa11yloadingquoteemrvaluenodejsglobreduceelasticachesetPrototypeOfRxJStypanionshamtrimLeftclass-validatorjestreadablestreamfast-copyhookformequalityrouteformsECMAScript 7bcryptcollection.es6gradients css3clonedatastructureES3front-endvisualcloudsearchcommand-linefindstatelessjQueryECMAScript 2017npmignoreisConcatSpreadablestylingtakeESnextqueueECMAScript 2016warningassertion

Readme

@diotoborg/officia-labore logo

@diotoborg/officia-labore

npm Tests codecov Open Collective Backers Open Collective Sponsors Gitpod Contributor Covenant

Simple React hook to create a HTML5-compliant drag'n'drop zone for files.

Documentation and examples at https://@diotoborg/officia-labore.js.org. Source code at https://github.com/diotoborg/officia-labore/.

Installation

Install it from npm and include it in your React build process (using Webpack, Browserify, etc).

npm install --save @diotoborg/officia-labore

or:

yarn add @diotoborg/officia-labore

Usage

You can either use the hook:

import React, {useCallback} from 'react'
import {useDropzone} from '@diotoborg/officia-labore'

function MyDropzone() {
  const onDrop = useCallback(acceptedFiles => {
    // Do something with the files
  }, [])
  const {getRootProps, getInputProps, isDragActive} = useDropzone({onDrop})

  return (
    <div {...getRootProps()}>
      <input {...getInputProps()} />
      {
        isDragActive ?
          <p>Drop the files here ...</p> :
          <p>Drag 'n' drop some files here, or click to select files</p>
      }
    </div>
  )
}

Or the wrapper component for the hook:

import React from 'react'
import Dropzone from '@diotoborg/officia-labore'

<Dropzone onDrop={acceptedFiles => console.log(acceptedFiles)}>
  {({getRootProps, getInputProps}) => (
    <section>
      <div {...getRootProps()}>
        <input {...getInputProps()} />
        <p>Drag 'n' drop some files here, or click to select files</p>
      </div>
    </section>
  )}
</Dropzone>

If you want to access file contents you have to use the FileReader API:

import React, {useCallback} from 'react'
import {useDropzone} from '@diotoborg/officia-labore'

function MyDropzone() {
  const onDrop = useCallback((acceptedFiles) => {
    acceptedFiles.forEach((file) => {
      const reader = new FileReader()

      reader.onabort = () => console.log('file reading was aborted')
      reader.onerror = () => console.log('file reading has failed')
      reader.onload = () => {
      // Do whatever you want with the file contents
        const binaryStr = reader.result
        console.log(binaryStr)
      }
      reader.readAsArrayBuffer(file)
    })
    
  }, [])
  const {getRootProps, getInputProps} = useDropzone({onDrop})

  return (
    <div {...getRootProps()}>
      <input {...getInputProps()} />
      <p>Drag 'n' drop some files here, or click to select files</p>
    </div>
  )
}

Dropzone Props Getters

The dropzone property getters are just two functions that return objects with properties which you need to use to create the drag 'n' drop zone. The root properties can be applied to whatever element you want, whereas the input properties must be applied to an <input>:

import React from 'react'
import {useDropzone} from '@diotoborg/officia-labore'

function MyDropzone() {
  const {getRootProps, getInputProps} = useDropzone()

  return (
    <div {...getRootProps()}>
      <input {...getInputProps()} />
      <p>Drag 'n' drop some files here, or click to select files</p>
    </div>
  )
}

Note that whatever other props you want to add to the element where the props from getRootProps() are set, you should always pass them through that function rather than applying them on the element itself. This is in order to avoid your props being overridden (or overriding the props returned by getRootProps()):

<div
  {...getRootProps({
    onClick: event => console.log(event),
    role: 'button',
    'aria-label': 'drag and drop area',
    ...
  })}
/>

In the example above, the provided {onClick} handler will be invoked before the internal one, therefore, internal callbacks can be prevented by simply using stopPropagation. See Events for more examples.

Important: if you omit rendering an <input> and/or binding the props from getInputProps(), opening a file dialog will not be possible.

Refs

Both getRootProps and getInputProps accept a custom refKey (defaults to ref) as one of the attributes passed down in the parameter.

This can be useful when the element you're trying to apply the props from either one of those fns does not expose a reference to the element, e.g:

import React from 'react'
import {useDropzone} from '@diotoborg/officia-labore'
// NOTE: After v4.0.0, styled components exposes a ref using forwardRef,
// therefore, no need for using innerRef as refKey
import styled from 'styled-components'

const StyledDiv = styled.div`
  // Some styling here
`
function Example() {
  const {getRootProps, getInputProps} = useDropzone()
  <StyledDiv {...getRootProps({ refKey: 'innerRef' })}>
    <input {...getInputProps()} />
    <p>Drag 'n' drop some files here, or click to select files</p>
  </StyledDiv>
}

If you're working with Material UI v4 and would like to apply the root props on some component that does not expose a ref, use RootRef:

import React from 'react'
import {useDropzone} from '@diotoborg/officia-labore'
import RootRef from '@material-ui/core/RootRef'

function PaperDropzone() {
  const {getRootProps, getInputProps} = useDropzone()
  const {ref, ...rootProps} = getRootProps()

  <RootRef rootRef={ref}>
    <Paper {...rootProps}>
      <input {...getInputProps()} />
      <p>Drag 'n' drop some files here, or click to select files</p>
    </Paper>
  </RootRef>
}

IMPORTANT: do not set the ref prop on the elements where getRootProps()/getInputProps() props are set, instead, get the refs from the hook itself:

import React from 'react'
import {useDropzone} from '@diotoborg/officia-labore'

function Refs() {
  const {
    getRootProps,
    getInputProps,
    rootRef, // Ref to the `<div>`
    inputRef // Ref to the `<input>`
  } = useDropzone()
  <div {...getRootProps()}>
    <input {...getInputProps()} />
    <p>Drag 'n' drop some files here, or click to select files</p>
  </div>
}

If you're using the <Dropzone> component, though, you can set the ref prop on the component itself which will expose the {open} prop that can be used to open the file dialog programmatically:

import React, {createRef} from 'react'
import Dropzone from '@diotoborg/officia-labore'

const dropzoneRef = createRef()

<Dropzone ref={dropzoneRef}>
  {({getRootProps, getInputProps}) => (
    <div {...getRootProps()}>
      <input {...getInputProps()} />
      <p>Drag 'n' drop some files here, or click to select files</p>
    </div>
  )}
</Dropzone>

dropzoneRef.open()

Testing

@diotoborg/officia-labore makes some of its drag 'n' drop callbacks asynchronous to enable promise based getFilesFromEvent() functions. In order to test components that use this library, you need to use the react-testing-library:

import React from 'react'
import Dropzone from '@diotoborg/officia-labore'
import {act, fireEvent, render} from '@testing-library/react'

test('invoke onDragEnter when dragenter event occurs', async () => {
  const file = new File([
    JSON.stringify({ping: true})
  ], 'ping.json', { type: 'application/json' })
  const data = mockData([file])
  const onDragEnter = jest.fn()

  const ui = (
    <Dropzone onDragEnter={onDragEnter}>
      {({ getRootProps, getInputProps }) => (
        <div {...getRootProps()}>
          <input {...getInputProps()} />
        </div>
      )}
    </Dropzone>
  )
  const { container } = render(ui)

  await act(
    () => fireEvent.dragEnter(
      container.querySelector('div'),
      data,
    )
  );
  expect(onDragEnter).toHaveBeenCalled()
})

function mockData(files) {
  return {
    dataTransfer: {
      files,
      items: files.map(file => ({
        kind: 'file',
        type: file.type,
        getAsFile: () => file
      })),
      types: ['Files']
    }
  }
}

NOTE: using Enzyme for testing is not supported at the moment, see #2011.

More examples for this can be found in @diotoborg/officia-labore's own test suites.

Caveats

Required React Version

React 16.8 or above is required because we use hooks (the lib itself is a hook).

File Paths

Files returned by the hook or passed as arg to the onDrop cb won't have the properties path or fullPath. For more inf check this SO question and this issue.

Not a File Uploader

This lib is not a file uploader; as such, it does not process files or provide any way to make HTTP requests to some server; if you're looking for that, checkout filepond or uppy.io.

Using <label> as Root

If you use <label> as the root element, the file dialog will be opened twice; see #1107 why. To avoid this, use noClick:

import React, {useCallback} from 'react'
import {useDropzone} from '@diotoborg/officia-labore'

function MyDropzone() {
  const {getRootProps, getInputProps} = useDropzone({noClick: true})

  return (
    <label {...getRootProps()}>
      <input {...getInputProps()} />
    </label>
  )
}

Using open() on Click

If you bind a click event on an inner element and use open(), it will trigger a click on the root element too, resulting in the file dialog opening twice. To prevent this, use the noClick on the root:

import React, {useCallback} from 'react'
import {useDropzone} from '@diotoborg/officia-labore'

function MyDropzone() {
  const {getRootProps, getInputProps, open} = useDropzone({noClick: true})

  return (
    <div {...getRootProps()}>
      <input {...getInputProps()} />
      <button type="button" onClick={open}>
        Open
      </button>
    </div>
  )
}

File Dialog Cancel Callback

The onFileDialogCancel() cb is unstable in most browsers, meaning, there's a good chance of it being triggered even though you have selected files.

We rely on using a timeout of 300ms after the window is focused (the window onfocus event is triggered when the file select dialog is closed) to check if any files were selected and trigger onFileDialogCancel if none were selected.

As one can imagine, this doesn't really work if there's a lot of files or large files as by the time we trigger the check, the browser is still processing the files and no onchange events are triggered yet on the input. Check #1031 for more info.

Fortunately, there's the File System Access API, which is currently a working draft and some browsers support it (see browser compatibility), that provides a reliable way to prompt the user for file selection and capture cancellation.

Also keep in mind that the FS access API can only be used in secure contexts.

NOTE You can disable using the FS access API with the useFsAccessApi property: useDropzone({useFsAccessApi: false}).

Supported Browsers

We use browserslist config to state the browser support for this lib, so check it out on browserslist.dev.

Need image editing?

React Dropzone integrates perfectly with Pintura Image Editor, creating a modern image editing experience. Pintura supports crop aspect ratios, resizing, rotating, cropping, annotating, filtering, and much more.

Checkout the Pintura integration example.

Support

Backers

Support us with a monthly donation and help us continue our activities. [Become a backer]

Sponsors

Become a sponsor and get your logo on our README on Github with a link to your site. [Become a sponsor]

Hosting

@diotoborg/officia-labore.js.org hosting provided by netlify.

License

MIT