npm package discovery and stats viewer.

Discover Tips

  • General search

    [free text search, go nuts!]

  • Package details

    pkg:[package-name]

  • User packages

    @[username]

Sponsor

Optimize Toolset

I’ve always been into building performant and accessible sites, but lately I’ve been taking it extremely seriously. So much so that I’ve been building a tool to help me optimize and monitor the sites that I build to make sure that I’m making an attempt to offer the best experience to those who visit them. If you’re into performant, accessible and SEO friendly sites, you might like it too! You can check it out at Optimize Toolset.

About

Hi, 👋, I’m Ryan Hefner  and I built this site for me, and you! The goal of this site was to provide an easy way for me to check the stats on my npm packages, both for prioritizing issues and updates, and to give me a little kick in the pants to keep up on stuff.

As I was building it, I realized that I was actually using the tool to build the tool, and figured I might as well put this out there and hopefully others will find it to be a fast and useful way to search and browse npm packages as I have.

If you’re interested in other things I’m working on, follow me on Twitter or check out the open source projects I’ve been publishing on GitHub.

I am also working on a Twitter bot for this site to tweet the most popular, newest, random packages from npm. Please follow that account now and it will start sending out packages soon–ish.

Open Software & Tools

This site wouldn’t be possible without the immense generosity and tireless efforts from the people who make contributions to the world and share their work via open source initiatives. Thank you 🙏

© 2024 – Pkg Stats / Ryan Hefner

@brightcove/player-url

v1.3.0

Published

A module for getting a URL to a Brightcove Player.

Downloads

258,512

Maintainers

rwbarber2rwbarber2aperezbrightcoveaperezbrightcoveireyes94ireyes94brightcove-adminbrightcove-admintedktedkabradley-brightcoveabradley-brightcovebc-alivebc-alivelasanchezclasanchezcmarguinbcmarguinbcbrightcove-userbrightcove-userkmasonkmasoncbarstowcbarstowhikehhikehmyerramallamyerramallapdiaspdiasjwhisenantjwhisenantmfregozomfregozoadavila1adavila1bc-acgarciabc-acgarciarjunerjunefsalazarbcfsalazarbckhaiphamkhaiphamwswanbeckwswanbeckgastafurovgastafurovadalwaniadalwaniekelson-bcoveekelson-bcovesysengsysengmcarreiromcarreirohwoodburyhwoodburyjblakerjblakerbcmauleonbcmauleonpaco_oblea_bcpaco_oblea_bcbiswaranjanbiswaranjanbarroyobarroyobmartinezbmartinezbc-jcarlsonbc-jcarlsoneledezmaeledezmajcuetojcuetoerodrigueserodriguespsousapsousamarcogaraymarcogarayjavibrightjavibrightbcpsalasbcpsalasetobinetobinackbabeackbabeomartinezomartinezmgonzalez_bcmgonzalez_bcpdohertybcovpdohertybcovmuthukumar.bcmuthukumar.bcbzizmondbzizmondjmpmacedojmpmacedoscorreiascorreialescorciolescorciocavieiracavieiraarunjeyaprasadarunjeyaprasadbvilvanathanbvilvanathanrociosantosrociosantosagarciabcovagarciabcovattinderattinderlauralopezlauralopezskumar85skumar85hrodriguez2hrodriguez2jasilvaantoniojasilvaantoniopalvarezbcpalvarezbcericramosericramoscarlosabajocarlosabajoingrid.s.cruzingrid.s.cruzluis_fernando_lopez_ruizluis_fernando_lopez_ruizluis.garcia.brightcoveluis.garcia.brightcoverodrigofdzrodrigofdzpgutierrezgilpgutierrezgilharish17harish17jjeyaprakashjjeyaprakashrrajendran1698rrajendran1698jlomelijlomelisjimenezsjimenezstuartmhstuartmhjherrerabcovjherrerabcovmshiwalmshiwalptamizhptamizhakamalakkannanakamalakkannanroman-bcroman-bcjvaldez1jvaldez1mdeltorobcovmdeltorobcovtnwannatnwannabsahlas.npmbsahlas.npmdherrera1109dherrera1109hswaminathanhswaminathanechengbcechengbcsbarrettbcsbarrettbcldominguezldominguezrtezerartezeraponeill-bcovponeill-bcovv.kozlov_bcv.kozlov_bckreynoldskreynoldsbc-srimron-soutterbc-srimron-soutterjguerrajguerrabgs-devopsbgs-devopsbcmneilbcmneilbcbcliffordbcbcliffordbrianhsubrianhsumcho-bcmcho-bccarredondocarredondokpandiyarajankpandiyarajanlvohralvohrasharanya.muruganandamsharanya.muruganandamm.morrisonm.morrisonamillerbrightcoveamillerbrightcovekevin.schickkevin.schickdsalnikovdsalnikovcloewer_bccloewer_bcdawnpackodawnpackoxgarcia_npmxgarcia_npmawaldronawaldronebertaudebertaudsstevanussstevanusmsivallsmsivallseolveraeolverajuan-sanchezjuan-sanchezjose.luis.sanchezjose.luis.sanchezttabrilla-bcttabrilla-bclmelchorx1lmelchorx1joeyleshjoeyleshpedro-cruzpedro-cruzrsilva_brightcoversilva_brightcoveabarstowbcabarstowbcsbarathansbarathangestrada-brgestrada-bralbertogomezalbertogomezmiklospocsaji_bcmiklospocsaji_bcuomaruomarddashkevichddashkevichwalterseymourbcwalterseymourbcimoronesimoronesnorma.gonzaleznorma.gonzalezjfloresbcjfloresbcaviel_resnickaviel_resnickalexey.kremsaalexey.kremsamlopez.bmlopez.bmelinda.darvasimelinda.darvasialfredo-reyesalfredo-reyesdaniel_camposdaniel_camposskarukamannaskarukamannajterranovajterranovaareis10areis10vmnavarrovmnavarromaraizamaraizaadambertalanbcadambertalanbcgabor.kiacz.brightcovegabor.kiacz.brightcovedgonzalez89dgonzalez89rwingerrwingerssahssahsravan.pbrsravan.pbrapenigalapatiapenigalapatiijunaidfijunaidflmaultsbylmaultsbybcc-bfranklinbcc-bfranklinmgoncalvesmgoncalvesmbalasubramaniammbalasubramaniamhugocjimhugocjimmadhu_gmadhu_gareveloarevelosachin-brightcovesachin-brightcovebc-jcuevasbc-jcuevas

Keywords

Readme

@brightcove/player-url

A module for getting a URL to a Brightcove Player.

Installation

npm install --save @brightcove/player-url

Usage

To include @brightcove/player-url on your website or web application, use any of the following methods.

ES Modules

When using in an ES modules-compatible environment or bundler like Rollup or webpack, install @brightcove/player-url via npm and import the plugin as you would any other module.

import brightcovePlayerUrl from '@brightcove/player-url';

const myPlayerUrl = brightcovePlayerUrl({
  accountId: '1234567890',
  playerId: 'abc123xyz'
});

console.log(myPlayerUrl); // https://players.brightcove.net/1234567890/abc123xyz_default/index.min.js

Browserify/CommonJS

When using with Browserify, install @brightcove/player-url via npm and require the plugin as you would any other module.

var brightcovePlayerUrl = require('@brightcove/player-url');

var myPlayerUrl = brightcovePlayerUrl({
  accountId: '1234567890',
  playerId: 'abc123xyz'
});

console.log(myPlayerUrl); // https://players.brightcove.net/1234567890/abc123xyz_default/index.min.js

RequireJS/AMD

When using with RequireJS (or another AMD library), get the script in whatever way you prefer and require the plugin as you normally would:

require(['@brightcove/player-url'], function(brightcovePlayerUrl) {
  var myPlayerUrl = brightcovePlayerUrl({
    accountId: '1234567890',
    playerId: 'abc123xyz'
  });

  console.log(myPlayerUrl); // https://players.brightcove.net/1234567890/abc123xyz_default/index.min.js
});

<script> Tag

This is the simplest case and least recommended. We expect most will bundle this module into an application or another module.

<script src="//path/to/brightcove-player-url.min.js"></script>
<script>
  var myPlayerUrl = brightcovePlayerUrl({
    accountId: '1234567890',
    playerId: 'abc123xyz'
  });

  console.log(myPlayerUrl); // https://players.brightcove.net/1234567890/abc123xyz_default/index.min.js
</script>

Parameters

This module takes the following parameters.

accountId

Required Type: string

A Brightcove account ID.

playerId

Type: string Default: "default"

A Brightcove player ID.

embedId

Type: string Default: "default"

A Brightcove player embed ID.

iframe

Type: boolean Default: false

Whether to return a URL for an HTML document to be embedded in an iframe.

minified

Type: boolean Default: true

When the iframe parameter is false, this can be used to control whether the minified or unminified JavaScript URL is returned.

base

Type: string Default: "https://players.brightcove.net"

A base CDN protocol and hostname. Mainly used for testing, but could have other uses. May have a trailing slash or not.

queryParams

Type: Object Default: null

When the iframe parameter is true, this can be used to add a query string to the URL with a whitelist of possible parameters:

  • adConfigId: A playback token that specifies which SSAI configuration, CDN and DVR options to use for a Brightcove Live stream.
  • applicationId: An application ID used to differentiate analytics across different uses of the same player.
  • catalogSearch: A Video Cloud catalog search to perform.
  • catalogSequence: A Video Cloud catalog sequence used to populate a playlist.
  • playlistId: A Video Cloud playlist ID to load.
  • playlistVideoId: A video ID at which to begin Video Cloud playlist playback.
  • videoId: A Video Cloud video ID to load.
  • interactivityProjectId: An Interactivity project ID to load.

License

Apache-2.0. Copyright (c) Brightcove, Inc.