npm package discovery and stats viewer.

Discover Tips

  • General search

    [free text search, go nuts!]

  • Package details

    pkg:[package-name]

  • User packages

    @[username]

Sponsor

Optimize Toolset

I’ve always been into building performant and accessible sites, but lately I’ve been taking it extremely seriously. So much so that I’ve been building a tool to help me optimize and monitor the sites that I build to make sure that I’m making an attempt to offer the best experience to those who visit them. If you’re into performant, accessible and SEO friendly sites, you might like it too! You can check it out at Optimize Toolset.

About

Hi, 👋, I’m Ryan Hefner  and I built this site for me, and you! The goal of this site was to provide an easy way for me to check the stats on my npm packages, both for prioritizing issues and updates, and to give me a little kick in the pants to keep up on stuff.

As I was building it, I realized that I was actually using the tool to build the tool, and figured I might as well put this out there and hopefully others will find it to be a fast and useful way to search and browse npm packages as I have.

If you’re interested in other things I’m working on, follow me on Twitter or check out the open source projects I’ve been publishing on GitHub.

I am also working on a Twitter bot for this site to tweet the most popular, newest, random packages from npm. Please follow that account now and it will start sending out packages soon–ish.

Open Software & Tools

This site wouldn’t be possible without the immense generosity and tireless efforts from the people who make contributions to the world and share their work via open source initiatives. Thank you 🙏

© 2024 – Pkg Stats / Ryan Hefner

@0xsequence/wallet-contracts

v3.0.1

Published

Ethereum contracts for the Sequence Smart Wallet at [https://sequence.app](https://sequence.app).

Downloads

89

Vulnerabilities

Powered byPowered by Snyk
  • 0High
  • 0Medium
  • 0Low

Links

Maintainers

taylanpincetaylanpincemilkytastemilkytastenaivesheepnaivesheeppkieltykapkieltykaphabcphabcagusx1211agusx1211

Keywords

Readme

Sequence Smart Wallet Contracts

Ethereum contracts for the Sequence Smart Wallet at https://sequence.app.

For more information, visit https://sequence.build

Usage

Please visit https://sequence.app to access the Sequence Wallet via your Web Browser, or download "Sequence Wallet" from the respective Apple/Google stores.

You may also access, interface, or develop your own Sequence Wallet via sequence.js. The sequence.js library offers a full open source library to interact, create, deploy and manage a Sequence Smart Wallet Account, as defined by the contracts in this repository. Also see go-sequence for an implementation in Go.

Connecting your Dapp with Sequence Wallet

If you wish to use Sequence Wallet in your Dapp, simply use sequence.js. Sequence.js is an Ethereum client library built on ethers.js, that provides an additional Sequence Smart Wallet Signer.

Please refer to the sequence.js repository for usage instructions.

Developing a Custom Wallet UI for Sequence (Advanced!)

If you wish to use the Sequence Wallet Contracts @0xsequence/wallet-contracts directly:

  1. Install the contracts: pnpm add @0xsequence/wallet-contracts or npm install @0xsequence/wallet-contracts
  2. Install the Sequence Wallet libraries: pnpm add @0xsequence/wallet or npm install @0xsequence/wallet. You can view the source, of the wallet libraries, and review the Sequence tests for sample usage.

NOTE: this integration is only needed if you want low-level access to the Sequence Wallet contracts, such as if you'd building your own custom wallet, or perhaps a CLI tool for managing your wallet.

Security Review

@0xsequence/wallet-contracts has been audited by independent parties.

V2 Audits

V1 Audits

License

Copyright (c) 2017-present Horizon Blockchain Games Inc.

Licensed under Apache-2.0